Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Interferon alpha/beta receptor 2 (Ifnar2) Recombinant Protein | Ifnar2 recombinant protein

Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2), partial

Gene Names
Ifnar2; Ifnar-2; AI747302
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon alpha/beta receptor 2 (Ifnar2); Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2); partial; Ifnar2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-242aa; partial, Extracellular Domain
Sequence
SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page
Related Product Information for Ifnar2 recombinant protein
This protein is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. Multiple transcript variants encoding at least two different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.8 kDa
NCBI Official Full Name
interferon alpha/beta receptor 2 isoform b
NCBI Official Synonym Full Names
interferon (alpha and beta) receptor 2
NCBI Official Symbol
Ifnar2
NCBI Official Synonym Symbols
Ifnar-2; AI747302
NCBI Protein Information
interferon alpha/beta receptor 2
UniProt Protein Name
Interferon alpha/beta receptor 2
UniProt Gene Name
Ifnar2
UniProt Synonym Gene Names
IFN-R-2; IFN-alpha/beta receptor 2

Uniprot Description

Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 2 and isoform 3 may be potent inhibitors of type I IFN receptor activity.

Research Articles on Ifnar2

Similar Products

Product Notes

The Ifnar2 ifnar2 (Catalog #AAA1004138) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-242aa; partial, Extracellular Domain. The amino acid sequence is listed below: SLETITPSAF DGYPDEPCTI NITIRNSRLI LSWELENKSG PPANYTLWYT VMSKDENLTK VKNCSDTTKS SCDVTDKWLE GMESYVVAIV IVHRGDLTVC RCSDYIVPAN APLEPPEFEI VGFTDHINVT MEFPPVTSKI IQEKMKTTPF VIKEQIGDSV RKKHEPKVNN VTGNFTFVLR DLLPKTNYCV SLYFDDDPAI KSPLKCIVLQ PGQESGLSES A. It is sometimes possible for the material contained within the vial of "Interferon alpha/beta receptor 2 (Ifnar2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.