Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transcription initiation factor IIA subunit 1 (TfIIA-L) Recombinant Protein | TfIIA-L recombinant protein

Recombinant Drosophila melanogaster Transcription initiation factor IIA subunit 1 (TfIIA-L)

Gene Names
TfIIA-L; CG5930; CT18631; DmelCG5930; dTFIIA; TFIIA; tfiia-l; TFIIA-L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription initiation factor IIA subunit 1 (TfIIA-L); Recombinant Drosophila melanogaster Transcription initiation factor IIA subunit 1 (TfIIA-L); Recombinant Transcription initiation factor IIA subunit 1 (TfIIA-L); Transcription initiation factor IIA subunit 1; General transcription factor IIA subunit 1 dTFIIA-L Cleaved into the following 2 chains: 1. Transcription initiation factor IIA alpha chain; TfIIA-L recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
263-366aa; full length protein
Sequence
DSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAEMFDTD NVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKSNGDAEW
Sequence Length
366
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,268 Da
NCBI Official Full Name
transcription factor IIA L, isoform A
NCBI Official Synonym Full Names
Transcription factor IIA L
NCBI Official Symbol
TfIIA-L
NCBI Official Synonym Symbols
CG5930; CT18631; DmelCG5930; dTFIIA; TFIIA; tfiia-l; TFIIA-L
NCBI Protein Information
CG5930 gene product from transcript CG5930-RC; CG5930-PA; CG5930-PB; CG5930-PC; TfIIA-L-PA; TfIIA-L-PB; TfIIA-L-PC; transcription factor IIA L
UniProt Protein Name
Transcription initiation factor IIA subunit 1
UniProt Gene Name
TfIIA-L
UniProt Entry Name
TF2AA_DROME

Uniprot Description

Function: TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Subunit structure: Belongs to the TFIID complex which is composed of TATA binding protein (Tbp) and a number of TBP-associated factors (Tafs). TFIIA is a heterodimer of a unprocessed large subunit 1 and a small subunit gamma. It was originally believed to be a heterotrimer of an alpha (p30), a beta (p20) and a gamma subunit (p14). Interacts with Tbp. Taf4 interacts with TFIIA-L when TFIIA-L is in complex with Tbp. Ref.1

Subcellular location: Nucleus.

Post-translational modification: The precursor form (48 kDa) is cleaved to give rise to the alpha (30 kDa) and beta (20 kDa) subunits. Ref.1

Sequence similarities: Belongs to the TFIIA subunit 1 family.

Similar Products

Product Notes

The TfIIA-L tfiia-l (Catalog #AAA1002911) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 263-366aa; full length protein. The amino acid sequence is listed below: DSSDEDESEE SDDNIDNDDD DDLDKDDDED AEHEDAAEEE PLNSEDDVTD EDSAEMFDTD NVIVCQYDKI TRSRNKWKFY LKDGIMNMRG KDYVFQKSNG DAEW. It is sometimes possible for the material contained within the vial of "Transcription initiation factor IIA subunit 1 (TfIIA-L), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.