Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable palmitoyltransferase ZDHHC21 (ZDHHC21) Recombinant Protein | ZDHHC21 recombinant protein

Recombinant Bovine Probable palmitoyltransferase ZDHHC21 (ZDHHC21)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable palmitoyltransferase ZDHHC21 (ZDHHC21); Recombinant Bovine Probable palmitoyltransferase ZDHHC21 (ZDHHC21); Recombinant Probable palmitoyltransferase ZDHHC21 (ZDHHC21); Probable palmitoyltransferase ZDHHC21 EC= 2.3.1.-; Zinc finger DHHC domain-containing protein 21; DHHC-21; ZDHHC21 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-265
Sequence
MGLRIHFVVDPHGWCCMGLIVFVWLYNFFLIPKIVLFPHYEEGHIPGILIIIFYGIAMFCLVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVVRHELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTRWKILWFIPFRRRQPLRVPYHFANHV
Sequence Length
265
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,463 Da
NCBI Official Full Name
probable palmitoyltransferase ZDHHC21
NCBI Official Synonym Full Names
zinc finger, DHHC-type containing 21
NCBI Official Symbol
ZDHHC21
NCBI Protein Information
probable palmitoyltransferase ZDHHC21; DHHC-21; zinc finger DHHC domain-containing protein 21
UniProt Protein Name
Probable palmitoyltransferase ZDHHC21
Protein Family
UniProt Gene Name
ZDHHC21
UniProt Synonym Gene Names
DHHC-21
UniProt Entry Name
ZDH21_BOVIN

Uniprot Description

Function: Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptor

By similarity.

Catalytic activity: Palmitoyl-CoA + protein-cysteine = S-palmitoyl protein + CoA.

Subcellular location: Membrane; Multi-pass membrane protein

Potential. Golgi apparatus

By similarity.

Domain: The DHHC domain is required for palmitoyltransferase activity

By similarity.

Sequence similarities: Belongs to the DHHC palmitoyltransferase family.Contains 1 DHHC-type zinc finger.

Similar Products

Product Notes

The ZDHHC21 zdhhc21 (Catalog #AAA1002854) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-265. The amino acid sequence is listed below: MGLRIHFVVD PHGWCCMGLI VFVWLYNFFL IPKIVLFPHY EEGHIPGILI IIFYGIAMFC LVALVRASIT DPGRLPENPK IPHGEREFWE LCNKCNLMRP KRSHHCSRCG HCVRRMDHHC PWINNCVGED NHWLFLQLCF YTELLTCYAL MFSFCHYYYF LPLKKRNLDL FVVRHELAIM RLAAFMGITM LVGITGLFYT QLIGIITDTT SIEKMSNCCE EISRPRKPWQ QTFSEVFGTR WKILWFIPFR RRQPLRVPYH FANHV. It is sometimes possible for the material contained within the vial of "Probable palmitoyltransferase ZDHHC21 (ZDHHC21), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.