Virion egress protein 24 Recombinant Protein | 24 recombinant protein
Recombinant Varicella-zoster virus Virion egress protein 24 (24)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Virion egress protein 24; Recombinant Varicella-zoster virus Virion egress protein 24 (24); 24 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-269aa; full length protein
Sequence
MSRRTYVRSERRRGCGDNLLQRIRLVVPSALQCCDGDLPIFDPQRPPARCVFQFNGEDNV SEAFPVEYIMRLMANWAQVDCDPYIKIQNTGVSVLFQGFFFRPTNAPVAEVSIDSNNVIL SSTLSTGINLSALESIKRGGGIDRRPLQALMWVNCFVRMPYVQLSFRFMGPEDPSRTIKL MARATDAYMYKETGNNLDEYIRWRPSFRSPPENGSPNTSVQMQSDIKPALPDTQTTRVWK LALPVANVTYALFIVIVLVVVLGAVLFWK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for 24 recombinant protein
NCBI and Uniprot Product Information
Uniprot Description
Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.
Similar Products
Product Notes
The Virion egress protein 24 24 (Catalog #AAA7041299) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-269aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Virion egress protein 24 24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSRRTYVRSE RRRGCGDNLL QRIRLVVPSA LQCCDGDLPI FDPQRPPARC VFQFNGEDNV SEAFPVEYIM RLMANWAQVD CDPYIKIQNT GVSVLFQGFF FRPTNAPVAE VSIDSNNVIL SSTLSTGINL SALESIKRGG GIDRRPLQAL MWVNCFVRMP YVQLSFRFMG PEDPSRTIKL MARATDAYMY KETGNNLDEY IRWRPSFRSP PENGSPNTSV QMQSDIKPAL PDTQTTRVWK LALPVANVTY ALFIVIVLVV VLGAVLFWK. It is sometimes possible for the material contained within the vial of "Virion egress protein 24, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
