Encapsidation protein (16) Recombinant Protein | B103_16 recombinant protein
Recombinant Bacillus phage B103 Encapsidation protein (16)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Encapsidation protein (16); Recombinant Bacillus phage B103 Encapsidation protein (16); B103_16 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-321, Full length protein
Sequence
MLSYDRILNFVIGARGIGKSYAMKKHPIKRFIKHGEQFIYVRRYKPELKKIGNYFNDIAQEFPNHEFKVKGRQFCIDGKLTGWAIPLSAWQSEKSNAYPMVTTIIFDEFIRERDNSGYIPNEVDALLNLMDTVFRTRENGRCICLSNAVSIINPYFVYFGLVPDINKRFNAYKHILIEIPDSKDFSDERRKTKFGQLIDGTEYGEMSLDNEFVNDSDVFIEKRSKNSKFVFSIVYKGMRMGVWVDTQQMLLYLTTDHDPSTKNVYALTADDLEEGMILVSNYKKNYHIRKLCSAFMNGQLRFDNQLMRTIGYEMFKKMRVQ
Sequence Length
321
Species
Bacillus phage B103 (Bacteriophage B103)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,651 Da
NCBI Official Full Name
encapsidation protein
NCBI Official Symbol
B103_16
NCBI Protein Information
DNA encapsidation protein
UniProt Protein Name
DNA packaging protein
UniProt Gene Name
16
UniProt Synonym Gene Names
gp16
Uniprot Description
ATPase required for the genome encapsidation reaction. Part of the active packaging motor via the binding to the packaging RNA (pRNA), itself fixed to the head-tail connector at the unique portal vertex of the prohead. Binds and supercoils the DNA-gp3 to produce an initiation complex for DNA packaging. Provides the energy to actively pump the viral DNA into the prohead. Approximately one molecule of ATP is used in the packaging of 2 bp of viral DNA. After packaging, the ATPase and the pRNA are released from the prohead.
Similar Products
Product Notes
The B103_16 16 (Catalog #AAA1474605) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-321, Full length protein. The amino acid sequence is listed below: MLSYDRILNF VIGARGIGKS YAMKKHPIKR FIKHGEQFIY VRRYKPELKK IGNYFNDIAQ EFPNHEFKVK GRQFCIDGKL TGWAIPLSAW QSEKSNAYPM VTTIIFDEFI RERDNSGYIP NEVDALLNLM DTVFRTRENG RCICLSNAVS IINPYFVYFG LVPDINKRFN AYKHILIEIP DSKDFSDERR KTKFGQLIDG TEYGEMSLDN EFVNDSDVFI EKRSKNSKFV FSIVYKGMRM GVWVDTQQML LYLTTDHDPS TKNVYALTAD DLEEGMILVS NYKKNYHIRK LCSAFMNGQL RFDNQLMRTI GYEMFKKMRV Q. It is sometimes possible for the material contained within the vial of "Encapsidation protein (16), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
