14-3-3 protein zeta (14-3-3zeta) Recombinant Protein | 14-3-3zeta recombinant protein

Recombinant Drosophila melanogaster 14-3-3 protein zeta (14-3-3zeta)

Gene Names

14-3-3zeta; 14-3-3; 14-3-3 zeta; 14-3-3-Leo; 14-3-3-zeta; 14-3-3leo; 14-3-3ZETA; 2G1; 4-3-3 zeta; 5.11; 549; BEST:GH05075; CG17870; D14-3-3; d14-3-3zeta; D14-3-3zeta; DmelCG17870; K; l(2)07103; l(2)46CFe; l(2)46Ee; leo; Leo; LEO; par-5; Par-5; PAR-5; PAR5

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

14-3-3 protein zeta (14-3-3zeta); Recombinant Drosophila melanogaster 14-3-3 protein zeta (14-3-3zeta); 14-3-3zeta recombinant protein

Ordering
Cat. Num. AAA1120814 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-248, Full length protein

Sequence

MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN

Sequence Length

248

Species

Drosophila melanogaster (Fruit fly)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

62471695

NCBI GeneID

36059

NCBI Accession #

NP_001014515.1

NCBI GenBank Nucleotide #

NM_001014515.2

UniProt Accession #

P29310; O01665; Q0E9D5; Q0E9D6; Q0E9D7; Q8IGB9; Q8MKV5; Q9V5G6; A4UZB2; A4UZB3; C1C593; C9QP27

Molecular Weight

28,304 Da

NCBI Official Full Name

14-3-3zeta, isoform J

NCBI Official Symbol

14-3-3zeta

NCBI Official Synonym Symbols

14-3-3; 14-3-3 zeta; 14-3-3-Leo; 14-3-3-zeta; 14-3-3leo; 14-3-3ZETA; 2G1; 4-3-3 zeta; 5.11; 549; BEST:GH05075; CG17870; D14-3-3; d14-3-3zeta; D14-3-3zeta; DmelCG17870; K; l(2)07103; l(2)46CFe; l(2)46Ee; leo; Leo; LEO; par-5; Par-5; PAR-5; PAR5

NCBI Protein Information

CG17870 gene product from transcript CG17870-RE

UniProt Protein Name

14-3-3 protein zeta

UniProt Gene Name

14-3-3zeta

UniProt Synonym Gene Names

14-3-3; 14-3-3EZ; leo; THAP

Uniprot Description

Required in Raf-dependent cell proliferation and photoreceptor differentiation during eye development (PubMed:9159395). Acts upstream of Raf and downstream of Ras, and is essential for viability (PubMed:9159395). Acts as a negative regulator of the slo calcium channel via its interaction with slo-binding protein slob (PubMed:10230800). Inhibits yki activity by restricting its nuclear localization (PubMed:19900439). Binds to and promotes the activity of phosphoinositide 3-kinase Pi3K68D which converts phosphatidylinositol to phosphatidylinositol-3-phosphate and promotes maturation of early endosomes (PubMed:27015288).

Research Articles on 14-3-3zeta

1. The Khc73 stalk/14-3-3/NudE pathway defines a physical connection that coordinates the activities of multiple motor proteins to precisely position the spindle.

Similar Products

14-3-3zeta ELISA Kit

Host: n/a

Reactivity: Human

Apps: n/a

Product Notes

The 14-3-3zeta 14-3-3zeta (Catalog #AAA1120814) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-248, Full length protein. The amino acid sequence is listed below: MSTVDKEELV QKAKLAEQSE RYDDMAQAMK SVTETGVELS NEERNLLSVA YKNVVGARRS SWRVISSIEQ KTEASARKQQ LAREYRERVE KELREICYEV LGLLDKYLIP KASNPESKVF YLKMKGDYYR YLAEVATGDA RNTVVDDSQT AYQDAFDISK GKMQPTHPIR LGLALNFSVF YYEILNSPDK ACQLAKQAFD DAIAELDTLN EDSYKDSTLI MQLLRDNLTL WTSDTQGDEA EPQEGGDN. It is sometimes possible for the material contained within the vial of "14-3-3 protein zeta (14-3-3zeta), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...