U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 (ZRSR2) Recombinant Protein | ZRSR2 recombinant protein

Recombinant Human U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 (ZRSR2)

Cat. Num. AAA1472931

• Gene Names: ZRSR2; URP; ZC3H22; U2AF1L2; U2AF1RS2; U2AF1-RS2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 (ZRSR2); Recombinant Human U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 (ZRSR2); ZRSR2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-482, Full length protein
• Sequence: MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
• Sequence Length: 482

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for ZRSR2 recombinant protein

This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3 splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly.

NCBI and Uniprot Product Information

• NCBI GI #: 4827046
• NCBI GeneID: 8233
• NCBI Accession #: NP_005080.1
• NCBI GenBank Nucleotide #: NM_005089.3
• UniProt Accession #: Q15696; Q14D69
• Molecular Weight: 58,045 Da
• NCBI Official Full Name: U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
• NCBI Official Synonym Full Names: zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2
• NCBI Official Symbol: ZRSR2
• NCBI Official Synonym Symbols: URP; ZC3H22; U2AF1L2; U2AF1RS2; U2AF1-RS2
• NCBI Protein Information: U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
• UniProt Protein Name: U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
• Protein Family: U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein
• UniProt Gene Name: ZRSR2
• UniProt Synonym Gene Names: U2AF1-RS2; U2AF1L2; U2AF1RS2; URP; URP

NCBI Description

This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly. [provided by RefSeq, Jul 2008]

Uniprot Description

Pre-mRNA-binding protein required for splicing of both U2- and U12-type introns. Selectively interacts with the 3'-splice site of U2- and U12-type pre-mRNAs and promotes different steps in U2 and U12 intron splicing. Recruited to U12 pre-mRNAs in an ATP-dependent manner and is required for assembly of the prespliceosome, a precursor to other spliceosomal complexes. For U2-type introns, it is selectively and specifically required for the second step of splicing.