Innexin inx4 (zpg) Recombinant Protein | zpg recombinant protein
Recombinant Drosophila melanogaster Innexin inx4 (zpg)
Gene Names
zpg; CG10125; Dm-inx4; DmelCG10125; FBpp0076692; inx-4; inx4; Inx4; Zpg
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Innexin inx4 (zpg); Recombinant Drosophila melanogaster Innexin inx4 (zpg); zpg recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-367aa; full length protein
Sequence
MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQCFGDKDM DYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVPPENRNYITYYQWVVLVLLLE SFVFYMPAFLWKIWEGGRLKHLCDDFHKMAVCKDKSRTHLRVLVNYFSSDYKETHFRYFV SYVFCEILNLSISILNFLLLDVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKC EMYKGGPSGSSNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEELYEAQSLIKI PPGADKI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for zpg recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,784 Da
NCBI Official Full Name
zero population growth, isoform B
NCBI Official Synonym Full Names
zero population growth
NCBI Official Symbol
zpg
NCBI Official Synonym Symbols
CG10125; Dm-inx4; DmelCG10125; FBpp0076692; inx-4; inx4; Inx4; Zpg
NCBI Protein Information
CG10125 gene product from transcript CG10125-RB
UniProt Protein Name
Innexin inx4
Protein Family
UniProt Gene Name
zpg
UniProt Synonym Gene Names
inx4; Innexin-4
UniProt Entry Name
INX4_DROME
Uniprot Description
Structural component of the gap junctions in germline cells. Required for differentiation and survival of germline cysts in females and of spermatogonia in males; gap junctional communication between spermatogonia and somatic cyst cells may be required for normal differentiation and survival of spermatogonia.
Research Articles on zpg
Similar Products
Product Notes
The zpg zpg (Catalog #AAA7035811) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-367aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the zpg zpg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYAAVKPLSK YLQFKSVHIY DAIFTLHSKV TVALLLACTF LLSSKQYFGD PIQCFGDKDM DYVHAFCWIY GAYVSDNVTV TPLRNGAAQC RPDAVSKVVP PENRNYITYY QWVVLVLLLE SFVFYMPAFL WKIWEGGRLK HLCDDFHKMA VCKDKSRTHL RVLVNYFSSD YKETHFRYFV SYVFCEILNL SISILNFLLL DVFFGGFWGR YRNALLSLYN GDYNQWNIIT MAVFPKCAKC EMYKGGPSGS SNIYDYLCLL PLNILNEKIF AFLWIWFILV AMLISLKFLY RLATVLYPGM RLQLLRARAR FMPKKHLQVA LRNCSFGDWF VLMRVGNNIS PELFRKLLEE LYEAQSLIKI PPGADKI. It is sometimes possible for the material contained within the vial of "Innexin inx4 (zpg), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
