Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zona pellucida sperm-binding protein 3 (ZP3) Recombinant Protein | ZP3 recombinant protein

Recombinant Macaca radiata Zona pellucida sperm-binding protein 3 (ZP3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zona pellucida sperm-binding protein 3 (ZP3); Recombinant Macaca radiata Zona pellucida sperm-binding protein 3 (ZP3); Recombinant Zona pellucida sperm-binding protein 3 (ZP3); Zona pellucida sperm-binding protein 3; Sperm receptor Zona pellucida glycoprotein 3; Zp-3 Zona pellucida protein C Cleaved into the following chain: 1. Processed zona pellucida sperm-binding prote; ZP3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-387aa; Extracellular domain
Sequence
QPFWLLQGGASRAETSVQPVLVECREATLLVTVSKDLFGTGKLIRAADLTLGPEACEPLV SMDTEDVVRFEVGLHECGSSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRY PRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEI HTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQ FTVDVFHFANDSRNMIYITCHLKAIPAEQEPDELNKACSFSKSSNSWFPVEGPADICQCC SKGDCGTPSHSRRQPHVVSQWSRSASRNRRHVTEEADITVGPLIFLDRSADYEVEQWALP ADTSV
Sequence Length
424
Species
Macaca radiata (Bonnet macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
47,040 Da
NCBI Official Full Name
Zona pellucida sperm-binding protein 3
UniProt Protein Name
Zona pellucida sperm-binding protein 3
UniProt Gene Name
ZP3
UniProt Synonym Gene Names
ZPC; Zp-3
UniProt Entry Name
ZP3_MACRA

Uniprot Description

Function: The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for sperm binding and zona matrix formation.

Subunit structure: Polymers of ZP2 and ZP3 organized into long filaments cross-linked by ZP1 homodimers

By similarity.

Subcellular location: Processed zona pellucida sperm-binding protein 3: Secreted › extracellular space › extracellular matrix. Cell membrane; Single-pass type I membrane protein.

Tissue specificity: Oocytes.

Domain: The ZP domain is involved in the polymerization of the ZP proteins to form the zona pellucida.

Post-translational modification: Proteolytically cleaved before the transmembrane segment to yield the secreted ectodomain incorporated in the zona pellucida.N-glycosylated

By similarity.O-glycosylated; removal of O-linked glycans may play an important role in the post-fertilization block to polyspermy

By similarity.

Sequence similarities: Belongs to the ZP domain family. ZPC subfamily.Contains 1 ZP domain.

Similar Products

Product Notes

The Zona pellucida sperm-binding protein 3 (ZP3) zp3 (Catalog #AAA1210333) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-387aa; Extracellular domain. The amino acid sequence is listed below: QPFWLLQGGA SRAETSVQPV LVECREATLL VTVSKDLFGT GKLIRAADLT LGPEACEPLV SMDTEDVVRF EVGLHECGSS MQVTDDALVY STFLLHDPRP VGNLSIVRTN RAEIPIECRY PRQGNVSSQA ILPTWLPFRT TVFSEEKLTF SLRLMEENWN AEKRSPTFHL GDAAHLQAEI HTGSHVPLRL FVDHCVATPT PDQNASPYHT IVDFHGCLVD GLTDASSAFK VPRPGPDTLQ FTVDVFHFAN DSRNMIYITC HLKAIPAEQE PDELNKACSF SKSSNSWFPV EGPADICQCC SKGDCGTPSH SRRQPHVVSQ WSRSASRNRR HVTEEADITV GPLIFLDRSA DYEVEQWALP ADTSV. It is sometimes possible for the material contained within the vial of "Zona pellucida sperm-binding protein 3 (ZP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.