E3 ubiquitin-protein ligase ZNF645 (ZNF645) Recombinant Protein | ZNF645 recombinant protein
Recombinant Human E3 ubiquitin-protein ligase ZNF645 (ZNF645)
Gene Names
CBLL2; CT138; HAKAIL; ZNF645
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase ZNF645 (ZNF645); Recombinant Human E3 ubiquitin-protein ligase ZNF645 (ZNF645); ZNF645 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-425, Full length protein
Sequence
MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPGYRWGDIKINIIGEKDDLPIHFCDKCDLPIKIYGRIIPCKHAFCYHCANLYDKVGYKVCPRCRYPVLRIEAHKRGSVFMCSIVQQCKRTYLSQKSLQAHIKRRHKRARKQVTSASLEKVRPHIAPPQTEISDIPKRLQDRDHLSYIPPEQHTMVSLPSVQHMLQEQHNQPHKDIQAPPPELSLSLPFPIQWETVSIFTRKHGNLTVDHIQNNSDSGAKKPTPPDYYPECQSQPAVSSPHHIIPQKQHYAPPPSPSSPVNHQMPYPPQDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY
Sequence Length
425
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,785 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase ZNF645
NCBI Official Synonym Full Names
Cbl proto-oncogene like 2
NCBI Official Symbol
CBLL2
NCBI Official Synonym Symbols
CT138; HAKAIL; ZNF645
NCBI Protein Information
E3 ubiquitin-protein ligase ZNF645
UniProt Protein Name
E3 ubiquitin-protein ligase ZNF645
Protein Family
UniProt Gene Name
ZNF645
NCBI Description
This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control. [provided by RefSeq, Aug 2011]
Uniprot Description
E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. May operate on tyrosine-phosphorylated SRC substrates.
Research Articles on ZNF645
Similar Products
Product Notes
The ZNF645 znf645 (Catalog #AAA1285289) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-425, Full length protein. The amino acid sequence is listed below: MNKMPAGEQE CEYNKEGKYY SKGVKLVRKK KKIPGYRWGD IKINIIGEKD DLPIHFCDKC DLPIKIYGRI IPCKHAFCYH CANLYDKVGY KVCPRCRYPV LRIEAHKRGS VFMCSIVQQC KRTYLSQKSL QAHIKRRHKR ARKQVTSASL EKVRPHIAPP QTEISDIPKR LQDRDHLSYI PPEQHTMVSL PSVQHMLQEQ HNQPHKDIQA PPPELSLSLP FPIQWETVSI FTRKHGNLTV DHIQNNSDSG AKKPTPPDYY PECQSQPAVS SPHHIIPQKQ HYAPPPSPSS PVNHQMPYPP QDVVTPNSVR SQVPALTTTY DPSSGYIIVK VPPDMNSPPL RAPQSQNGNP SASEFASHHY NLNILPQFTE NQETLSPQFT QTDAMDHRRW PAWKRLSPCP PTRSPPPSTL HGRSHHSHQR RHRRY. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase ZNF645 (ZNF645), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
