Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein ZNF365 (ZNF365) Recombinant Protein | ZNF365 recombinant protein

Recombinant Human Protein ZNF365 (ZNF365)

Gene Names
ZNF365; UAN; Su48; ZNF365D
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein ZNF365 (ZNF365); Recombinant Human Protein ZNF365 (ZNF365); ZNF365 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-407, Full length protein
Sequence
MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII
Sequence Length
407
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,036 Da
NCBI Official Full Name
protein ZNF365 isoform A
NCBI Official Synonym Full Names
zinc finger protein 365
NCBI Official Symbol
ZNF365
NCBI Official Synonym Symbols
UAN; Su48; ZNF365D
NCBI Protein Information
protein ZNF365
UniProt Protein Name
Protein ZNF365
Protein Family
UniProt Gene Name
ZNF365

NCBI Description

This gene encodes several isoforms which have different expression patterns and functions. Mutation in this gene is associated with uric acid nephrolithiasis (UAN). Alternatively spliced variants, encoding distinct proteins, have been identified. [provided by RefSeq, May 2010]

Uniprot Description

Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth (PubMed:17389905). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in the positive regulation of oligodendrocyte differentiation during postnatal growth. Involved in dendritic arborization, morphogenesis of spine density dendrite, and establishment of postsynaptic dendrite density in cortical pyramidal neurons (). Involved in homologous recombination (HR) repair pathway. Required for proper resolution of DNA double-strand breaks (DSBs) by HR. Is required for recovery of stalled replication forks, and directly contributes to genomic stability. Interacts with PARP1 and mediates MRE11-dependent DNA end resection during replication fork recovery (PubMed:23966166). Contributes to genomic stability by preventing telomere dysfunction (PubMed:23776040).

Research Articles on ZNF365

Similar Products

Product Notes

The ZNF365 znf365 (Catalog #AAA1319589) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-407, Full length protein. The amino acid sequence is listed below: MQQKAFEESR YPWQESFENV AVCLPLRCPR CGDHTRFRSL SSLRAHLEFS HSYEERTLLT KCSLFPSLKD TDLVTSSELL KPGKLQSSGN VVKQKPSYVN LYSISHEHSK DRKPFEVVAE RPVSYVQTYT AMDLHADSLD GTRSGPGLPT SDTKASFEAH VREKFNRMVE AVDRTIEKRI DKLTKELAQK TAELLEVRAA FVQLTQKKQE VQRRERALNR QVDVAVEMIA VLRQRLTESE EELLRKEEEV VTFNHFLEAA AEKEVQGKAR LQDFIENLLQ RVELAEKQLE YYQSQQASGF VRDLSGHVLT DISSNRKPKC LSRGHPHSVC NHPDLKAHFH PKGRNHLKKA KDDRASMQPA KAIHEQAESS RDLCRPPKKG ELLGFGRKGN IRPKMAKKKP TAIVNII. It is sometimes possible for the material contained within the vial of "Protein ZNF365 (ZNF365), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.