Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tristetraprolin (ZFP36) Recombinant Protein | ZFP36 recombinant protein

Recombinant Bovine Tristetraprolin (ZFP36)

Gene Names
ZFP36; TTP; TIS11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tristetraprolin (ZFP36); Recombinant Bovine Tristetraprolin (ZFP36); ZFP36 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-324, Full length protein
Sequence
MDLAAIYKSLLSLSPELPSDLGETESSTSWASSGPWSLSSSDSSLPEVAARLPGRSTSLVEGRSCGWVPPPPGFAPLAPRPSSDWSPSPTSPTATPTTSSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQASRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPHVLRQSISFSGLPSGRRTSPPPASLAGPSVSSWSFSPSSSPPPPPGDLLLSPSAFSAAPGHLCRRDPTPACCPSCRRATPNSVWGPVGGLARSPSAHSLGSDPDEYASSGTSLGGSDSPVFEAGVFGPPQPPAAPRRLPIFNRISVSE
Sequence Length
324
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,087 Da
NCBI Official Full Name
tristetraprolin
NCBI Official Synonym Full Names
ZFP36 ring finger protein
NCBI Official Symbol
ZFP36
NCBI Official Synonym Symbols
TTP; TIS11
NCBI Protein Information
tristetraprolin
UniProt Protein Name
mRNA decay activator protein ZFP36
UniProt Gene Name
ZFP36
UniProt Synonym Gene Names
Zfp-36

Uniprot Description

Zinc-finger RNA-binding protein that destabilizes numerous cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis. Acts as an 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery. Recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1, and hence promotes ARE-mediated mRNA deadenylation. Functions also by recruiting components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs. Self regulates by destabilizing its own mRNA. Binds to 3'-UTR ARE of numerous mRNAs. Binds also to ARE of its own mRNA. Plays a role in anti-inflammatory responses; suppresses tumor necrosis factor (TNF)-alpha production by stimulating ARE-mediated TNF-alpha mRNA decay and several other inflammatory ARE-containing mRNAs in interferon (IFN)- and/or lipopolysaccharide (LPS)-induced macrophages. Plays also a role in the regulation of dendritic cell maturation at the post-transcriptional level, and hence operates as part of a negative feedback loop to limit the inflammatory response. Promotes ARE-mediated mRNA decay of hypoxia-inducible factor HIF1A mRNA during the response of endothelial cells to hypoxia. Positively regulates early adipogenesis of preadipocytes by promoting ARE-mediated mRNA decay of immediate early genes (IEGs). Negatively regulates hematopoietic/erythroid cell differentiation by promoting ARE-mediated mRNA decay of the transcription factor STAT5B mRNA. Plays a role in maintaining skeletal muscle satellite cell quiescence by promoting ARE-mediated mRNA decay of the myogenic determination factor MYOD1 mRNA. Associates also with and regulates the expression of non-ARE-containing target mRNAs at the post-transcriptional level, such as MHC class I mRNAs. Participates in association with argonaute RISC catalytic components in the ARE-mediated mRNA decay mechanism; assists microRNA (miRNA) targeting ARE-containing mRNAs. May also play a role in the regulation of cytoplasmic mRNA decapping; enhances decapping of ARE-containing RNAs, in vitro. Involved in the delivery of target ARE-mRNAs to processing bodies (PBs). In addition to its cytosolic mRNA-decay function, affects nuclear pre-mRNA processing. Negatively regulates nuclear poly(A)-binding protein PABPN1-stimulated polyadenylation activity on ARE-containing pre-mRNA during LPS-stimulated macrophages. Also involved in the regulation of stress granule (SG) and P-body (PB) formation and fusion. Plays a role in the regulation of keratinocyte proliferation, differentiation and apoptosis. Plays a role as a tumor suppressor by inhibiting cell proliferation in breast cancer cells.

Similar Products

Product Notes

The ZFP36 zfp36 (Catalog #AAA961123) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-324, Full length protein. The amino acid sequence is listed below: MDLAAIYKSL LSLSPELPSD LGETESSTSW ASSGPWSLSS SDSSLPEVAA RLPGRSTSLV EGRSCGWVPP PPGFAPLAPR PSSDWSPSPT SPTATPTTSS RYKTELCRTF SESGRCRYGA KCQFAHGLGE LRQASRHPKY KTELCHKFYL QGRCPYGSRC HFIHNPSEDL AAPGHPHVLR QSISFSGLPS GRRTSPPPAS LAGPSVSSWS FSPSSSPPPP PGDLLLSPSA FSAAPGHLCR RDPTPACCPS CRRATPNSVW GPVGGLARSP SAHSLGSDPD EYASSGTSLG GSDSPVFEAG VFGPPQPPAA PRRLPIFNRI SVSE. It is sometimes possible for the material contained within the vial of "Tristetraprolin (ZFP36), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.