Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable ribonuclease ZC3H12D (Zc3h12d) Recombinant Protein | Zc3h12d recombinant protein

Recombinant Mouse Probable ribonuclease ZC3H12D (Zc3h12d)

Gene Names
Zc3h12d; TFL; D730019B10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ribonuclease ZC3H12D (Zc3h12d); Recombinant Mouse Probable ribonuclease ZC3H12D (Zc3h12d); Zc3h12d recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-533, Full length protein
Sequence
MEHRSKMEFFQKLGYSQEDVVRVLGKLGDSALVNDVLQELIQTGSRPRAQEDPASGTGVVLIPRGCCGVQDSAQQGPGTRPRRGWRRSSPLLRPIVIDGSNVAMSHGNKEAFSCRGIRLAVDWFTDRGHTYIKVFVPSWRKEPSRSDTPIREQHVLEELERQAVLVYTPSRKVNGKRVVCYDDRYIVKVAYEKDGIIVSNDNYRDLQNENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRRGPTLSNFLSKKPRPPEPSWQHCPYGKKCTYGVKCRFYHPERPHHGQLSVADELRAKTRAWLGGGAEEPRTPSARSRPTTARLLPQEPGEHDLPPAPQPAVLAALNRSFARLTFSDTAASGVVSQSRGPDWMPTGVPTSWAPPSLRAGSAATIGLPGMRSLRTPNNPLSPGDLGSPICPQARLSERHRSRDMHSDLPPQRRPLEDPWALLPSSYCYLNHSVWSESAWGEDIFRGPSESAQPVANGGGTRPVHCSFFPPDQDHPVMASGPPLSDMALLTLLQRSQKTGAPLGDP
Sequence Length
533
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,340 Da
NCBI Official Full Name
probable ribonuclease ZC3H12D
NCBI Official Synonym Full Names
zinc finger CCCH type containing 12D
NCBI Official Symbol
Zc3h12d
NCBI Official Synonym Symbols
TFL; D730019B10Rik
NCBI Protein Information
probable ribonuclease ZC3H12D
UniProt Protein Name
Probable ribonuclease ZC3H12D
Protein Family
UniProt Gene Name
Zc3h12d

Uniprot Description

May regulate cell growth likely by suppressing RB1 phosphorylation (). May function as RNase and regulate the levels of target RNA species (Potential). In association with ZC3H12A enhances the degradation of interleukin IL-6 mRNA level in activated macrophages (PubMed:26134560). Serve as a tumor suppressor in certain leukemia cells (). Overexpression inhibits the G1 to S phase progression through suppression of RB1 phosphorylation ().

Research Articles on Zc3h12d

Similar Products

Product Notes

The Zc3h12d zc3h12d (Catalog #AAA1303460) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-533, Full length protein. The amino acid sequence is listed below: MEHRSKMEFF QKLGYSQEDV VRVLGKLGDS ALVNDVLQEL IQTGSRPRAQ EDPASGTGVV LIPRGCCGVQ DSAQQGPGTR PRRGWRRSSP LLRPIVIDGS NVAMSHGNKE AFSCRGIRLA VDWFTDRGHT YIKVFVPSWR KEPSRSDTPI REQHVLEELE RQAVLVYTPS RKVNGKRVVC YDDRYIVKVA YEKDGIIVSN DNYRDLQNEN PEWKWFIEQR LLMFSFVNDR FMPPDDPLGR RGPTLSNFLS KKPRPPEPSW QHCPYGKKCT YGVKCRFYHP ERPHHGQLSV ADELRAKTRA WLGGGAEEPR TPSARSRPTT ARLLPQEPGE HDLPPAPQPA VLAALNRSFA RLTFSDTAAS GVVSQSRGPD WMPTGVPTSW APPSLRAGSA ATIGLPGMRS LRTPNNPLSP GDLGSPICPQ ARLSERHRSR DMHSDLPPQR RPLEDPWALL PSSYCYLNHS VWSESAWGED IFRGPSESAQ PVANGGGTRP VHCSFFPPDQ DHPVMASGPP LSDMALLTLL QRSQKTGAPL GDP. It is sometimes possible for the material contained within the vial of "Probable ribonuclease ZC3H12D (Zc3h12d), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.