Zinc-binding alcohol dehydrogenase domain-containing protein 2 (Zadh2) Recombinant Protein | Zadh2 recombinant protein
Recombinant Mouse Zinc-binding alcohol dehydrogenase domain-containing protein 2 (Zadh2)
Gene Names
Zadh2; Pthr3; PTGR-3; C530046K17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc-binding alcohol dehydrogenase domain-containing protein 2 (Zadh2); Recombinant Mouse Zinc-binding alcohol dehydrogenase domain-containing protein 2 (Zadh2); Zadh2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-377, full length protein
Sequence
MLRLAAAGARAIVDMSYARHFLDFQGSAIPRTMQKLVVTRLSPNFHEAVTLRRDCPVPLPGDGDLLVRNRFVGINASDINYSAGRYDPSLKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIAIPMPSVKPEYLTMLVSGTTAYLSLEELGELSEGKKVLVTAAAGGTGQFAVQLSKIAKCHVIGTCSSDEKAAFLKSIGCDRPINYRTEPVETVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTGLSPIKAGVLPTKLLKKSASLRGFFLNHYFSKYQAAMERLLELYARGDLVCEVDLGHLAPDGRFIGLESVFQAVDYMYTGKNTGKLVVELPHPVSSKL
Sequence Length
377
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,529 Da
NCBI Official Full Name
prostaglandin reductase-3
NCBI Official Synonym Full Names
zinc binding alcohol dehydrogenase, domain containing 2
NCBI Official Symbol
Zadh2
NCBI Official Synonym Symbols
Pthr3; PTGR-3; C530046K17Rik
NCBI Protein Information
prostaglandin reductase-3; zinc-binding alcohol dehydrogenase domain-containing protein 2
UniProt Protein Name
Prostaglandin reductase-3
Protein Family
UniProt Gene Name
Zadh2
UniProt Synonym Gene Names
; PTGR-3
Uniprot Description
Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-keto-PGE1, 15-keto-PGE2, 15-keto-PGE1-alpha and 15-keto-PGE2-alpha with highest efficienty towards 15-keto-PGE2-alpha. Overexpression represses transcriptional activity of PPARG and inhibits adipocyte differentiation.
Research Articles on Zadh2
Similar Products
Product Notes
The Zadh2 zadh2 (Catalog #AAA1428663) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-377, full length protein. The amino acid sequence is listed below: MLRLAAAGAR AIVDMSYARH FLDFQGSAIP RTMQKLVVTR LSPNFHEAVT LRRDCPVPLP GDGDLLVRNR FVGINASDIN YSAGRYDPSL KPPFDIGFEG IGEVVALGLS ASARYTVGQA VAYMAPGSFA EYTVVPASIA IPMPSVKPEY LTMLVSGTTA YLSLEELGEL SEGKKVLVTA AAGGTGQFAV QLSKIAKCHV IGTCSSDEKA AFLKSIGCDR PINYRTEPVE TVLKQEYPEG VDVVYESVGG AMFDLAVDAL ATKGRLIVIG FISGYQSPTG LSPIKAGVLP TKLLKKSASL RGFFLNHYFS KYQAAMERLL ELYARGDLVC EVDLGHLAPD GRFIGLESVF QAVDYMYTGK NTGKLVVELP HPVSSKL. It is sometimes possible for the material contained within the vial of "Zinc-binding alcohol dehydrogenase domain-containing protein 2 (Zadh2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
