Spore morphogenesis and germination protein ywcE (ywcE) Recombinant Protein | ywcE recombinant protein
Recombinant Bacillus subtilis Spore morphogenesis and germination protein ywcE (ywcE)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Spore morphogenesis and germination protein ywcE (ywcE); Recombinant Bacillus subtilis Spore morphogenesis and germination protein ywcE (ywcE); Recombinant Spore morphogenesis and germination protein ywcE (ywcE); Spore morphogenesis and germination protein ywcE; ywcE recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-87
Sequence
MMDMFFAYLLVASATPLFIWLDNKKVALSAIPPIILMWVFFFFYATESLSPLGHTLMIILFAVNVIVAHIAAFIIYGLPYLRRKRSS
Sequence Length
87
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,959 Da
NCBI Official Full Name
protein required for proper spore morphogenesis and germination
NCBI Official Symbol
ywcE
NCBI Protein Information
protein required for proper spore morphogenesis and germination
UniProt Protein Name
Spore morphogenesis and germination protein YwcE
Protein Family
UniProt Gene Name
ywcE
UniProt Entry Name
YWCE_BACSU
Uniprot Description
Function: Required for proper spore morphogenesis. Important for spore germination. Ref.3
Subcellular location: Cell membrane. Spore core membrane; Multi-pass membrane protein. Spore wall › spore outer membrane; Multi-pass membrane protein. Note: Inner and outer prespore membrane. Mother cell membrane. Ref.3
Developmental stage: Expressed at the onset of sporulation.
Induction: Repressed by AbrB during growth and activated at the onset of sporulation in a Spo0A-dependent manner.
Sequence similarities: Belongs to the YwcE family.
Similar Products
Product Notes
The ywcE ywce (Catalog #AAA1215439) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-87. The amino acid sequence is listed below: MMDMFFAYLL VASATPLFIW LDNKKVALSA IPPIILMWVF FFFYATESLS PLGHTLMIIL FAVNVIVAHI AAFIIYGLPY LRRKRSS. It is sometimes possible for the material contained within the vial of "Spore morphogenesis and germination protein ywcE (ywcE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
