Probable ATP-dependent RNA helicase YTHDC2 (Ythdc2) Recombinant Protein | Ythdc2 recombinant protein
Recombinant Mouse Probable ATP-dependent RNA helicase YTHDC2 (Ythdc2) , partial
Gene Names
Ythdc2; BC037178; 3010002F02Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ATP-dependent RNA helicase YTHDC2 (Ythdc2); Recombinant Mouse Probable ATP-dependent RNA helicase YTHDC2 (Ythdc2); partial; Ythdc2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
218-384, Partial, provide the Helicase ATP-binding domain
Sequence
VKIIKENKVVLIVGETGSGKTTQIPQFLLDDCFKNGIPCRIFCTQPRRLAAIAVAERVAAERRERIGQTIGYQIRLESRVSPKTLLTFCTNGVLLRTLMAGDSTLSTVTHVIVDEVHERDRFSDFLLTKLRDLLQKHPTLKLILSSAALDVNLFIRYFGSCPVIYIQ
Sequence Length
384
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
161,092 Da
NCBI Official Full Name
probable ATP-dependent RNA helicase YTHDC2
NCBI Official Synonym Full Names
YTH domain containing 2
NCBI Official Symbol
Ythdc2
NCBI Official Synonym Symbols
BC037178; 3010002F02Rik
NCBI Protein Information
probable ATP-dependent RNA helicase YTHDC2
UniProt Protein Name
Probable ATP-dependent RNA helicase YTHDC2
Protein Family
UniProt Gene Name
Ythdc2
Uniprot Description
Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs affecting the translation efficiency and mRNA abundance of its targets. Is required for proper spermatocyte development (PubMed:28809393). M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. When associated with MEIOC, binds transcripts that regulate the mitotic cell cycle inhibiting progression into metaphase, thereby allowing meiotic prophase to proceed normally (PubMed:28380054).
Research Articles on Ythdc2
Similar Products
Product Notes
The Ythdc2 ythdc2 (Catalog #AAA1029851) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 218-384, Partial, provide the Helicase ATP-binding domain. The amino acid sequence is listed below: VKIIKENKVV LIVGETGSGK TTQIPQFLLD DCFKNGIPCR IFCTQPRRLA AIAVAERVAA ERRERIGQTI GYQIRLESRV SPKTLLTFCT NGVLLRTLMA GDSTLSTVTH VIVDEVHERD RFSDFLLTKL RDLLQKHPTL KLILSSAALD VNLFIRYFGS CPVIYIQ . It is sometimes possible for the material contained within the vial of "Probable ATP-dependent RNA helicase YTHDC2 (Ythdc2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
