ATP-dependent zinc metalloprotease YME1L1 (Yme1l1) Recombinant Protein | Yme1l1 recombinant protein
Recombinant Mouse ATP-dependent zinc metalloprotease YME1L1 (Yme1l1)
Gene Names
Yme1l1; Ftsh; FtsH1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent zinc metalloprotease YME1L1 (Yme1l1); Recombinant Mouse ATP-dependent zinc metalloprotease YME1L1 (Yme1l1); Yme1l1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-715aa; Full length protein
Sequence
MFSLSSTVQPQVTIPLSHLINAFHSPKNISVSVNTPVSQKQHRDTVPEHEAPSSEPVLNL RDLGLSELKIGQIDKMVENLLPGFYKDKRVSSCWHTSHISAQSFFENKYGHLDMFSTLRS SSLYRQHPKTLRSICSDLQYFPVFIQSRGFKTLKSRTRRLQSTSERLVEAQNIAPSFVKG FLLRDRGTDLESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLILF VLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQELQEVVEFL KNPQKFTVLGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGAS RIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVII IGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDKSVDPEIIARGT VGFSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAY HESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVSMGGR VAEELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIE QEIRILLRESYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKLEVR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Yme1l1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
80,028 Da
NCBI Official Full Name
ATP-dependent zinc metalloprotease YME1L1
NCBI Official Synonym Full Names
YME1-like 1 (S. cerevisiae)
NCBI Official Symbol
Yme1l1
NCBI Official Synonym Symbols
Ftsh; FtsH1
NCBI Protein Information
ATP-dependent zinc metalloprotease YME1L1
UniProt Protein Name
ATP-dependent zinc metalloprotease YME1L1
Protein Family
UniProt Gene Name
Yme1l1
UniProt Entry Name
YMEL1_MOUSE
Uniprot Description
YME1L1: Putative ATP-dependent protease which plays a role in mitochondrial protein metabolism. Ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity and protects mitochondria from the accumulation of oxidatively damaged membrane proteins. Requires to control the accumulation of nonassembled respiratory chain subunits (NDUFB6, OX4 and ND1). Seems to act in the processing of OPA1. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Mitochondrial; Protease; EC 3.4.24.-
Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion; nucleoplasm
Molecular Function: ATP binding; ATP-dependent peptidase activity; hydrolase activity; metal ion binding; metalloendopeptidase activity; metallopeptidase activity; nucleotide binding; peptidase activity
Biological Process: cell proliferation; misfolded or incompletely synthesized protein catabolic process; mitochondrion organization and biogenesis; proteolysis
Research Articles on Yme1l1
Similar Products
Product Notes
The Yme1l1 yme1l1 (Catalog #AAA7035171) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-715aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Yme1l1 yme1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFSLSSTVQP QVTIPLSHLI NAFHSPKNIS VSVNTPVSQK QHRDTVPEHE APSSEPVLNL RDLGLSELKI GQIDKMVENL LPGFYKDKRV SSCWHTSHIS AQSFFENKYG HLDMFSTLRS SSLYRQHPKT LRSICSDLQY FPVFIQSRGF KTLKSRTRRL QSTSERLVEA QNIAPSFVKG FLLRDRGTDL ESLDKLMKTK NIPEAHQDAF KTGFAEGFLK AQALTQKTND SLRRTRLILF VLLLFGIYGL LKNPFLSVRF RTTTGLDSAV DPVQMKNVTF EHVKGVEEAK QELQEVVEFL KNPQKFTVLG GKLPKGILLV GPPGTGKTLL ARAVAGEADV PFYYASGSEF DEMFVGVGAS RIRNLFREAK ANAPCVIFID ELDSVGGKRI ESPMHPYSRQ TINQLLAEMD GFKPNEGVII IGATNFPEAL DNALIRPGRF DMQVTVPRPD VKGRTEILKW YLNKIKFDKS VDPEIIARGT VGFSGAELEN LVNQAALKAA VDGKEMVTMK ELEFSKDKIL MGPERRSVEI DNKNKTITAY HESGHAIIAY YTKDAMPINK ATIMPRGPTL GHVSLLPEND RWNETRAQLL AQMDVSMGGR VAEELIFGTD HITTGASSDF DNATKIAKRM VTKFGMSEKL GVMTYSDTGK LSPETQSAIE QEIRILLRES YERAKHILKT HAKEHKNLAE ALLTYETLDA KEIQIVLEGK KLEVR. It is sometimes possible for the material contained within the vial of "ATP-dependent zinc metalloprotease YME1L1 (Yme1l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
