Uncharacterized membrane protein YjcC (yjcC) Recombinant Protein | yjcC recombinant protein
Recombinant Escherichia coli Uncharacterized membrane protein YjcC (yjcC)
Gene Names
yjcC; ECK4053; JW4022
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized membrane protein YjcC (yjcC); Recombinant Escherichia coli Uncharacterized membrane protein YjcC (yjcC); yjcC recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-528aa; full length protein
Sequence
MSHRARHQLLALPGIIFLVLFPIILSLWIAFLWAKSEVNNQLRTFAQLALDKSELVIRQA DLVSDAAERYQGQVCTPAHQKRMLNIIRGYLYINELIYARDNHFLCSSLIAPVNGYTIAP ADYKREPNVSIYYYRDTPFFSGYKMTYMQRGNYVAVINPLFWSEVMSDDPTLQWGVYDTV TKTFFSLSKEASAATFSPLIHLKDLTVQRNGYLYATVYSTKRPIAAIVATSYQRLITHFY NHLIFALPAGILGSLVLLLLWLRIRQNYLSPKRKLQRALEKHQLCLYYQPIIDIKTEKCI GAEALLRWPGEQGQIMNPAEFIPLAEKEGMIEQITDYVIDNVFRDLGDYLATHADRYVSI NLSASDFHTSRLIARINQKTEQYAVRPQQIKFEVTEHAFLDVDKMTPIILAFRQAGYEVA IDDFGIGYSNLHNLKSLNVDILKIDKSFVETLTTHKTSHLIAEHIIELAHSLGLKTIAEG VETEEQVNWLRKRGVRYCQGWFFAKAMPPQVFMQWMEQLPARELTRGQ
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for yjcC recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,801 Da
NCBI Official Full Name
putative membrane-anchored cyclic-di-GMP phosphodiesterase
NCBI Official Symbol
yjcC
NCBI Official Synonym Symbols
ECK4053; JW4022
NCBI Protein Information
putative membrane-anchored cyclic-di-GMP phosphodiesterase
UniProt Protein Name
Putative cyclic-di-GMP phosphodiesterase YjcC
Protein Family
UniProt Gene Name
yjcC
UniProt Entry Name
YJCC_ECOLI
NCBI Description
YjcC has a C-terminal putative cyclic-di-GMP phosphodiesterase EAL domain. [More information is available at EcoGene: EG11938]. YjcC is an inner membrane protein with two predicted transmembrane domains. [More information is available at EcoCyc: EG11938].
Uniprot Description
May function as a c-di-GMP phosphodiesterase. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria. Overexpression reduces biofilm formation.
Similar Products
Product Notes
The yjcC yjcc (Catalog #AAA7035072) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-528aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the yjcC yjcc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSHRARHQLL ALPGIIFLVL FPIILSLWIA FLWAKSEVNN QLRTFAQLAL DKSELVIRQA DLVSDAAERY QGQVCTPAHQ KRMLNIIRGY LYINELIYAR DNHFLCSSLI APVNGYTIAP ADYKREPNVS IYYYRDTPFF SGYKMTYMQR GNYVAVINPL FWSEVMSDDP TLQWGVYDTV TKTFFSLSKE ASAATFSPLI HLKDLTVQRN GYLYATVYST KRPIAAIVAT SYQRLITHFY NHLIFALPAG ILGSLVLLLL WLRIRQNYLS PKRKLQRALE KHQLCLYYQP IIDIKTEKCI GAEALLRWPG EQGQIMNPAE FIPLAEKEGM IEQITDYVID NVFRDLGDYL ATHADRYVSI NLSASDFHTS RLIARINQKT EQYAVRPQQI KFEVTEHAFL DVDKMTPIIL AFRQAGYEVA IDDFGIGYSN LHNLKSLNVD ILKIDKSFVE TLTTHKTSHL IAEHIIELAH SLGLKTIAEG VETEEQVNWL RKRGVRYCQG WFFAKAMPPQ VFMQWMEQLP ARELTRGQ. It is sometimes possible for the material contained within the vial of "Uncharacterized membrane protein YjcC (yjcC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
