Membrane protein insertase YidC 2 (yidC2) Recombinant Protein | yidC2 recombinant protein
Recombinant Lactobacillus plantarum Membrane protein insertase YidC 2 (yidC2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane protein insertase YidC 2 (yidC2); Recombinant Lactobacillus plantarum Membrane protein insertase YidC 2 (yidC2); yidC2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-277aa; full length protein
Sequence
CSNTPITDKSTGFWDGLIILNFSRAIIWLSNLFGHSYGLGIIVFTLIIRIIILPLMIFQT RNMVAMQEVQPQMKALQKKYSSRDMETQQKLQAEMKKLYAKHGVHPMASMLPLLVQLPIL IALYQAIWRTQALKTGSFLWLQLGSKDPYYVLPILAAIFTFASSWLAMKSQPEQNGMTTS MTYLMPVIILITAINVPSALSLYWVISNAFQVGQTLLLQNPFKINREREAKKQAERDRKR TLEKARKRAIRNHKR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for yidC2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,697 Da
NCBI Official Full Name
protein translocase component YidC
NCBI Official Symbol
yidC2
NCBI Protein Information
preprotein translocase, YidC subunit
UniProt Protein Name
Membrane protein insertase YidC 2
Protein Family
UniProt Gene Name
yidC2
UniProt Entry Name
YIDC2_LACPL
Uniprot Description
Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.
Similar Products
Product Notes
The yidC2 yidc2 (Catalog #AAA7034934) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-277aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the yidC2 yidc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CSNTPITDKS TGFWDGLIIL NFSRAIIWLS NLFGHSYGLG IIVFTLIIRI IILPLMIFQT RNMVAMQEVQ PQMKALQKKY SSRDMETQQK LQAEMKKLYA KHGVHPMASM LPLLVQLPIL IALYQAIWRT QALKTGSFLW LQLGSKDPYY VLPILAAIFT FASSWLAMKS QPEQNGMTTS MTYLMPVIIL ITAINVPSAL SLYWVISNAF QVGQTLLLQN PFKINREREA KKQAERDRKR TLEKARKRAI RNHKR. It is sometimes possible for the material contained within the vial of "Membrane protein insertase YidC 2 (yidC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
