Membrane protein insertase YidC (yidC) Recombinant Protein | yidC recombinant protein

Recombinant Cupriavidus taiwanensis Membrane protein insertase YidC (yidC)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Membrane protein insertase YidC (yidC); Recombinant Cupriavidus taiwanensis Membrane protein insertase YidC (yidC); Recombinant Membrane protein insertase YidC (yidC); Membrane protein insertase YidC; Foldase YidC Membrane integrase YidC Membrane protein YidC; yidC recombinant protein

Ordering

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-559

Sequence

MDIKRTILWVIFSMSLVLLYDNWQRANGHASMFFPSTTQQQAASAPAASGAAAQGDVPKANVQPATGTSAAPAAGAAPQAAAQPTGEKIVVTTDTVRAEIDTAGGIVSRLELLKEHEKDGKPVVLFERDNVRTYMARSGLIGGDLPNHTTVFTAAPGPRALDGAEQVQVVLTGEKNGVKLVKTYTFRKGSYVVDSKFDVTNAGTAPVSPTLYLELARDGSKVEQSQFYSTFTGPAIYTDADKYHKLSFEDIAKGKATVPAAANNGWVAMVQHYFASAWIPQTGKEHSFYVQQIDPNLYRVGIQQPLGELAPGATVSTDARLFAGPQEEHMLEKIAPGLELVKDYGWLTILAKPLFWLLEKLHGFLGNWGWSIIALTVLIKLVFFPLSAASYKSMGKMKDLQPRMTSIRERYKNDPQKMNQEMMALYRTEKVNPLGGCLPIVIQIPVFIALYWVLLSSVEMRGAPWLGWIHDLSVPDPFYILPIVMAVSMFVQTKLNPTPPDPVQAKVMMIMPLVFSVMFFFFPAGLVLYWVVNNILSIAQQWQINRMLGKGKAAVVAKS

Sequence Length

559

Species

Cupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424))

Preparation and Storage

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #

194291287

NCBI GeneID

6455137

NCBI Accession #

YP_002007194.1

NCBI GenBank Nucleotide #

NC_010528.1

UniProt Accession #

B3R883

Molecular Weight

61,370 Da

NCBI Official Full Name

inner membrane protein translocase component yidc

NCBI Official Symbol

yidC

NCBI Protein Information

inner membrane protein translocase component yidc

UniProt Protein Name

Membrane protein insertase YidC

Protein Family

Membrane protein insertase

UniProt Gene Name

yidC

UniProt Entry Name

YIDC_CUPTR

Uniprot Description

Function: Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins

By similarity. HAMAP-Rule MF_01810

Subunit structure: Interacts with the Sec translocase complex via SecD. Specifically interacts with transmembrane segments of nascent integral membrane proteins during membrane integration

By similarity.

Subcellular location: Cell inner membrane; Multi-pass membrane protein

By similarity HAMAP-Rule MF_01810.

Sequence similarities: Belongs to the OXA1/ALB3/YidC family. Type 1 subfamily.

Similar Products

Product Notes

The yidC yidc (Catalog #AAA1166103) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-559. The amino acid sequence is listed below: MDIKRTILWV IFSMSLVLLY DNWQRANGHA SMFFPSTTQQ QAASAPAASG AAAQGDVPKA NVQPATGTSA APAAGAAPQA AAQPTGEKIV VTTDTVRAEI DTAGGIVSRL ELLKEHEKDG KPVVLFERDN VRTYMARSGL IGGDLPNHTT VFTAAPGPRA LDGAEQVQVV LTGEKNGVKL VKTYTFRKGS YVVDSKFDVT NAGTAPVSPT LYLELARDGS KVEQSQFYST FTGPAIYTDA DKYHKLSFED IAKGKATVPA AANNGWVAMV QHYFASAWIP QTGKEHSFYV QQIDPNLYRV GIQQPLGELA PGATVSTDAR LFAGPQEEHM LEKIAPGLEL VKDYGWLTIL AKPLFWLLEK LHGFLGNWGW SIIALTVLIK LVFFPLSAAS YKSMGKMKDL QPRMTSIRER YKNDPQKMNQ EMMALYRTEK VNPLGGCLPI VIQIPVFIAL YWVLLSSVEM RGAPWLGWIH DLSVPDPFYI LPIVMAVSMF VQTKLNPTPP DPVQAKVMMI MPLVFSVMFF FFPAGLVLYW VVNNILSIAQ QWQINRMLGK GKAAVVAKS. It is sometimes possible for the material contained within the vial of "Membrane protein insertase YidC (yidC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...