Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Membrane protein insertase YidC (yidC) Recombinant Protein | Bcen2424_3163 recombinant protein

Recombinant Burkholderia cenocepacia Membrane protein insertase YidC (yidC)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane protein insertase YidC (yidC); Recombinant Burkholderia cenocepacia Membrane protein insertase YidC (yidC); Recombinant Membrane protein insertase YidC (yidC); Membrane protein insertase YidC; Foldase YidC Membrane integrase YidC Membrane protein YidC; Bcen2424_3163 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-552
Sequence
MDIKRTVLWVIFFMSAVMLYDNWQRDHGRPSMFFPSATHTAPAAAGGASGTSATTAGDVPAAAAGAAPSTTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYITLFDHTAGHTYLARTGLLGGDFPNHNDVYTQLNPGSTSLTGDENTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDNVGTAPVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKIDFSDLDKNKANFEKSSDNGWVAMVQHYFASAWIPQQGAKRDIYAEKIDPTLYRVGVKQPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHGYVGNWGWAIVLLTVLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPFFILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYITRKLGGVKKKPA
Sequence Length
552
Species
Burkholderia cenocepacia (strain HI2424)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,873 Da
NCBI Official Full Name
putative inner membrane protein translocase component YidC
NCBI Official Symbol
Bcen2424_3163
NCBI Protein Information
putative inner membrane protein translocase component YidC
UniProt Protein Name
Membrane protein insertase YidC
UniProt Gene Name
yidC
UniProt Entry Name
YIDC_BURCH

Uniprot Description

Function: Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins

By similarity. HAMAP-Rule MF_01810

Subunit structure: Interacts with the Sec translocase complex via SecD. Specifically interacts with transmembrane segments of nascent integral membrane proteins during membrane integration

By similarity.

Subcellular location: Cell inner membrane; Multi-pass membrane protein

By similarity HAMAP-Rule MF_01810.

Sequence similarities: Belongs to the OXA1/ALB3/YidC family. Type 1 subfamily.

Similar Products

Product Notes

The Bcen2424_3163 yidc (Catalog #AAA1111933) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-552. The amino acid sequence is listed below: MDIKRTVLWV IFFMSAVMLY DNWQRDHGRP SMFFPSATHT APAAAGGASG TSATTAGDVP AAAAGAAPST TAPAAQAQLV KFSTDVYDGE IDTRGGTLAK LTLKKQGDGK QPDLYITLFD HTAGHTYLAR TGLLGGDFPN HNDVYTQLNP GSTSLTGDEN TLKLSFESPV KGGVKVVKTY TFTRGSYVIG VDTKIDNVGT APVTPTVYME LVRDNTAVET PMFSHTFLGP AVYTDAKHFQ KIDFSDLDKN KANFEKSSDN GWVAMVQHYF ASAWIPQQGA KRDIYAEKID PTLYRVGVKQ PVAAIAPGQS ADVQARLFAG PEEERMLEGI APGLELVKDY GWVTIIAKPL FWLLEKIHGY VGNWGWAIVL LTVLIKAVFF PLSAASYKSM ARMKEITPRM QALRERFKSD PQKMNAALME LYKTEKVNPF GGCLPVVIQI PVFISLYWVL LASVEMRGAP WILWIHDLSQ RDPFFILPVL MAVSMFVQTS LNPTPPDPVQ AKMMKFMPIA FSVMFFFFPA GLVLYYVVNN VLSIAQQYYI TRKLGGVKKK PA. It is sometimes possible for the material contained within the vial of "Membrane protein insertase YidC (yidC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.