Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Membrane protein insertase YidC (yidC) Recombinant Protein | yidC recombinant protein

Recombinant Chlamydia trachomatis Membrane protein insertase YidC (yidC)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane protein insertase YidC (yidC); Recombinant Chlamydia trachomatis Membrane protein insertase YidC (yidC); yidC recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-787aa; full length protein
Sequence
CQIFFGYRDLKSCQDLAEKQRAISEQILASTEQLSVVPWTASLEESESVNQYAIRLGNRL LLLTKGGSHPEVYSRGTYWSLIEQTSTFGGILVSLYGETGQEVLSKGSSVYLPNQRDAFP VLVAEFRSNQEPLVFLGEYKDGKIANKAGAIYGTSLVFLNTGNGFVPLGIYNSKEECVES LDLPMARAVVFADKENPTASGSYYMLSNEYMQIVVSQESGAIEGINLPFASDQEENKSIV NEIGFDRELAINSPSEASFPGVETIDSQRQNIANVVGGYYPLLRRGTLSDVKKRVPAQYQ ALNIVSGRELASPVATGFRVVSFDNKTLILESGDGGIRRTYSLGEQPYAFELEIQTTQGR EDLWITSGVPEVEIMSNAFVPAVKYHAVKKNKSDLFNVKLPKAKDSLLVRNNATPQWILN SNGYFGVILTPRIPIPAGYASSFIPGNVVPTRLSQLPPKDQAYPASKYPGYTAMLPLPKE AGRYQFMVYAGPLADPTLKALDRANANSKGETPEYVDAIAFRGFFSFITEPFAALLFVIM KFFKFLTGSWGISIILLTIVLKLLLYPLNAWSIRSMRRMQKLSPYIQEIQQKYKREPKRA QMEIMALYKMNKVNPITGCLPLLIQIPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDV LFSWETPIWFIGKEFHLLPILLGVVMFAQQKISAVKRSGPASDQQRQQEAMGTMMALLFT FMFYNFPSGLNIYWFSSMLLGVIQQWVTNKILDEKHLQHEVIINKKR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for yidC recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,024 Da
NCBI Official Full Name
membrane protein insertase
NCBI Official Symbol
CT_251
NCBI Protein Information
membrane protein insertase
UniProt Protein Name
Membrane protein insertase YidC
UniProt Gene Name
yidC
UniProt Entry Name
YIDC_CHLTR

Uniprot Description

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins ().

Similar Products

Product Notes

The yidC yidc (Catalog #AAA7034610) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-787aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the yidC yidc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CQIFFGYRDL KSCQDLAEKQ RAISEQILAS TEQLSVVPWT ASLEESESVN QYAIRLGNRL LLLTKGGSHP EVYSRGTYWS LIEQTSTFGG ILVSLYGETG QEVLSKGSSV YLPNQRDAFP VLVAEFRSNQ EPLVFLGEYK DGKIANKAGA IYGTSLVFLN TGNGFVPLGI YNSKEECVES LDLPMARAVV FADKENPTAS GSYYMLSNEY MQIVVSQESG AIEGINLPFA SDQEENKSIV NEIGFDRELA INSPSEASFP GVETIDSQRQ NIANVVGGYY PLLRRGTLSD VKKRVPAQYQ ALNIVSGREL ASPVATGFRV VSFDNKTLIL ESGDGGIRRT YSLGEQPYAF ELEIQTTQGR EDLWITSGVP EVEIMSNAFV PAVKYHAVKK NKSDLFNVKL PKAKDSLLVR NNATPQWILN SNGYFGVILT PRIPIPAGYA SSFIPGNVVP TRLSQLPPKD QAYPASKYPG YTAMLPLPKE AGRYQFMVYA GPLADPTLKA LDRANANSKG ETPEYVDAIA FRGFFSFITE PFAALLFVIM KFFKFLTGSW GISIILLTIV LKLLLYPLNA WSIRSMRRMQ KLSPYIQEIQ QKYKREPKRA QMEIMALYKM NKVNPITGCL PLLIQIPFLI AMFDLLKSSF LLRGASFIPG WIDNLTAPDV LFSWETPIWF IGKEFHLLPI LLGVVMFAQQ KISAVKRSGP ASDQQRQQEA MGTMMALLFT FMFYNFPSGL NIYWFSSMLL GVIQQWVTNK ILDEKHLQHE VIINKKR. It is sometimes possible for the material contained within the vial of "Membrane protein insertase YidC (yidC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.