Membrane protein insertase YidC (yidC) Recombinant Protein | yidC recombinant protein

Recombinant Chlamydia muridarum Membrane protein insertase YidC (yidC)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Membrane protein insertase YidC (yidC); Recombinant Chlamydia muridarum Membrane protein insertase YidC (yidC); yidC recombinant protein

Ordering
Cat. Num. AAA7034608 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

Cell Free Expression

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Liquid containing glycerol

Sequence Positions

21-787aa; full length protein

Sequence

CQIFFGYQDLKSCQDLAEKQRAISEQILASTEQLSVVPWTASAEESESVNQYAVRLGNRL LVLTKGGAHSEVHSKGTSWKLIDQTSTFGGILVSLYGEDGQEVLSKGGSVYLPNQQDALP VLVAEFRRNQEPLVFFGEYKNGKLSNKAGTIYGTSLVFLNTGNEFVPLGIYNSKEECVES LDLPMARAVVFADKENLTTSGSYYMLANEYMQVIVSQESGAIEGINLPFASDREGNKSIV NEIGFDRELAAGSPSEASFPGVQAIDSQRQNVSSVVGGYYPLLRRGTLSDTRKMVSPQYQ ALNIVSGRELSSPVATGFRVVSFDNKTLVLESGDGGIRKTYTLGEQPYAFDLEIQTTRGQ EDLWITSGVPEVEIMSNAFVPAVKYHAVKKNKSDLINVKLPKAKDSLLVRNDASPQWILN SNGYFGVILTPKTPLPTGYASSFIPGNAVPTRLTQLSPKDQAYPASKYPGYTAMLPLPKE AGRYQFMVYAGPLSEPTLKALDRAHTNHKGESPEYVDAIAFRGFFSFITEPFAALLFIIM KFFQFLTGSWGISIILLTIVLKLVLYPLNAWSIRSMRRMQKLSPYIQDIQQKYKREPKRA QMEIMALYKVNKVNPITGCLPLIIQIPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDV LFSWETPIWFIGKEFHLLPILLGIVMFAQQKISAIKRSGPVSDQQRQQEAMGTMMALLFT FMFYNFPSGLNIYWLSSMLLGVIQQWATNKILDEKHLQHEVIVNKKR

Sequence Length

Full length protein

Application Notes

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Species

Chlamydia muridarum (strain MoPn / Nigg)

Preparation and Storage

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for yidC recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

NCBI GI #

38503223

UniProt Accession #

Q9PKE3

Molecular Weight

87,736 Da

NCBI Official Full Name

Membrane protein insertase YidC

UniProt Protein Name

Membrane protein insertase YidC

Protein Family

Membrane protein insertase

UniProt Gene Name

yidC

UniProt Entry Name

YIDC_CHLMU

Uniprot Description

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins ().

Similar Products

Product Notes

The yidC yidc (Catalog #AAA7034608) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-787aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the yidC yidc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CQIFFGYQDL KSCQDLAEKQ RAISEQILAS TEQLSVVPWT ASAEESESVN QYAVRLGNRL LVLTKGGAHS EVHSKGTSWK LIDQTSTFGG ILVSLYGEDG QEVLSKGGSV YLPNQQDALP VLVAEFRRNQ EPLVFFGEYK NGKLSNKAGT IYGTSLVFLN TGNEFVPLGI YNSKEECVES LDLPMARAVV FADKENLTTS GSYYMLANEY MQVIVSQESG AIEGINLPFA SDREGNKSIV NEIGFDRELA AGSPSEASFP GVQAIDSQRQ NVSSVVGGYY PLLRRGTLSD TRKMVSPQYQ ALNIVSGREL SSPVATGFRV VSFDNKTLVL ESGDGGIRKT YTLGEQPYAF DLEIQTTRGQ EDLWITSGVP EVEIMSNAFV PAVKYHAVKK NKSDLINVKL PKAKDSLLVR NDASPQWILN SNGYFGVILT PKTPLPTGYA SSFIPGNAVP TRLTQLSPKD QAYPASKYPG YTAMLPLPKE AGRYQFMVYA GPLSEPTLKA LDRAHTNHKG ESPEYVDAIA FRGFFSFITE PFAALLFIIM KFFQFLTGSW GISIILLTIV LKLVLYPLNA WSIRSMRRMQ KLSPYIQDIQ QKYKREPKRA QMEIMALYKV NKVNPITGCL PLIIQIPFLI AMFDLLKSSF LLRGASFIPG WIDNLTAPDV LFSWETPIWF IGKEFHLLPI LLGIVMFAQQ KISAIKRSGP VSDQQRQQEA MGTMMALLFT FMFYNFPSGL NIYWLSSMLL GVIQQWATNK ILDEKHLQHE VIVNKKR. It is sometimes possible for the material contained within the vial of "Membrane protein insertase YidC (yidC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...