Mitochondrial nicotinamide adenine dinucleotide transporter 1 (YIA6) Recombinant Protein | YIA6 recombinant protein

Recombinant Saccharomyces cerevisiae Mitochondrial nicotinamide adenine dinucleotide transporter 1 (YIA6)

• Gene Names: YIA6; NDT1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mitochondrial nicotinamide adenine dinucleotide transporter 1 (YIA6); Recombinant Saccharomyces cerevisiae Mitochondrial nicotinamide adenine dinucleotide transporter 1 (YIA6); Recombinant Mitochondrial nicotinamide adenine dinucleotide transporter 1 (YIA6); Mitochondrial nicotinamide adenine dinucleotide transporter 1; Mitochondrial NAD(+) transporter 1; YIA6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-373
• Sequence: MTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEEQLIFPDHSSQLSSADIIEPIKMNSSTESIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENISTMVI
• Sequence Length: 373

• Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 6322185
• NCBI GeneID: 854811
• NCBI Accession #: NP_012260.1
• NCBI GenBank Nucleotide #: NM_001179356.1
• UniProt Accession #: P40556; D6VVS4
• Molecular Weight: 41,954 Da
• NCBI Official Full Name: Yia6p
• NCBI Official Symbol: YIA6
• NCBI Official Synonym Symbols: NDT1
• NCBI Protein Information: Yia6p
• UniProt Protein Name: Mitochondrial nicotinamide adenine dinucleotide transporter 1
• Protein Family: Mitochondrial nicotinamide adenine dinucleotide transporter
• UniProt Gene Name: YIA6
• UniProt Synonym Gene Names: NDT1
• UniProt Entry Name: YIA6_YEAST

Uniprot Description

Function: Mitochondrial inner membrane carrier protein involved in the import of NAD+ into mitochondria by unidirectional transport or by exchange with intramitochondrially generated dAMP and dGMP. Ref.3 Ref.4 Ref.5

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein Ref.5.

Sequence similarities: Belongs to the mitochondrial carrier family.Contains 3 Solcar repeats.

Caution: Was first identified as the mitochondrial pyruvate transporter (Ref.4). However, later experiments showed that was a NAD+ transporter (Ref.5).

Biophysicochemical propertiesKinetic parameters:KM=0.38 mM for NAD+ Ref.5Vmax=617 nmol/min/mg enzyme