Inner membrane transport protein ydiM (ydiM) Recombinant Protein | ydiM recombinant protein
Recombinant Escherichia coli Inner membrane transport protein ydiM (ydiM), partial
Gene Names
ydiM; ECK1688; JW1680
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inner membrane transport protein ydiM (ydiM); Recombinant Escherichia coli Inner membrane transport protein ydiM (ydiM); partial; ydiM recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-404
Sequence
MKNPYFPTALGLYFNYLVHGMGVLLMSLNMASLETLWQTNAAGVSIVISSLGIGRLSVLLFAGLLSDRFGRRPFIMLGMCCYMAFFFGILQTNNIIIAYVFGFLAGMANSFLDAGTYPSLMEAFPRSPGTANILIKAFVSSGQFLLPLIISLLVWAELWFGWSFMIAAGIMFINALFLYRCTFPPHPGRRLPVIKKTTSSTEHRCSIIDLASYTLYGYISMATFYLVSQWLAQYGQFVAGMSYTMSIKLLSIYTVGSLLCVFITAPLIRNTVRPTTLLMLYTFISFIALFTVCLHPTFYVVIIFAFVIGFTSAGGVVQIGLTLMAERFPYAKGKATGIYYSAGSIATFTIPLITAHLSQRSIADIMWFDTAIAAIGFLLALFIGLRSRKKTRHHSLKENVAPGG
Sequence Length
404
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,608 Da
NCBI Official Full Name
putative MFS transporter, membrane protein
NCBI Official Symbol
ydiM
NCBI Official Synonym Symbols
ECK1688; JW1680
NCBI Protein Information
putative MFS transporter, membrane protein
UniProt Protein Name
Inner membrane transport protein YdiM
Protein Family
UniProt Gene Name
ydiM
NCBI Description
Major Facilitator Superfamily (MFS). [More information is available at EcoGene: EG13972]. The YdiM protein is an uncharacterised member of the major facilitator superfamily (MFS) of transporters . [More information is available at EcoCyc: G6916].
Similar Products
Product Notes
The ydiM ydim (Catalog #AAA1019682) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-404. The amino acid sequence is listed below: MKNPYFPTAL GLYFNYLVHG MGVLLMSLNM ASLETLWQTN AAGVSIVISS LGIGRLSVLL FAGLLSDRFG RRPFIMLGMC CYMAFFFGIL QTNNIIIAYV FGFLAGMANS FLDAGTYPSL MEAFPRSPGT ANILIKAFVS SGQFLLPLII SLLVWAELWF GWSFMIAAGI MFINALFLYR CTFPPHPGRR LPVIKKTTSS TEHRCSIIDL ASYTLYGYIS MATFYLVSQW LAQYGQFVAG MSYTMSIKLL SIYTVGSLLC VFITAPLIRN TVRPTTLLML YTFISFIALF TVCLHPTFYV VIIFAFVIGF TSAGGVVQIG LTLMAERFPY AKGKATGIYY SAGSIATFTI PLITAHLSQR SIADIMWFDT AIAAIGFLLA LFIGLRSRKK TRHHSLKENV APGG. It is sometimes possible for the material contained within the vial of "Inner membrane transport protein ydiM (ydiM), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
