DNA-binding protein A (CSDA) Recombinant Protein | CSDA recombinant protein
Recombinant Human DNA-binding protein A (CSDA)
Gene Names
YBX3; CSDA; DBPA; CSDA1; ZONAB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA-binding protein A (CSDA); Recombinant Human DNA-binding protein A (CSDA); CSDA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-372, Full length protein
Sequence
SEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE
Sequence Length
371
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,021 Da
NCBI Official Full Name
Y-box-binding protein 3 isoform b
NCBI Official Synonym Full Names
Y-box binding protein 3
NCBI Official Symbol
YBX3
NCBI Official Synonym Symbols
CSDA; DBPA; CSDA1; ZONAB
NCBI Protein Information
Y-box-binding protein 3
UniProt Protein Name
Y-box-binding protein 3
Protein Family
UniProt Gene Name
YBX3
UniProt Synonym Gene Names
CSDA; DBPA
Uniprot Description
Binds to the GM-CSF promoter. Seems to act as a repressor. Binds also to full-length mRNA and to short RNA sequences containing the consensus site 5'-UCCAUCA-3'. May have a role in translation repression ().
Research Articles on CSDA
Similar Products
Product Notes
The CSDA ybx3 (Catalog #AAA960136) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-372, Full length protein. The amino acid sequence is listed below: SEAGEATTTT TTTLPQAPTE AAAAAPQDPA PKSPVGSGAP QAAAPAPAAH VAGNPGGDAA PAATGTAAAA SLATAAGSED AEKKVLATKV LGTVKWFNVR NGYGFINRND TKEDVFVHQT AIKKNNPRKY LRSVGDGETV EFDVVEGEKG AEAANVTGPD GVPVEGSRYA ADRRRYRRGY YGRRRGPPRN YAGEEEEEGS GSSEGFDPPA TDRQFSGARN QLRRPQYRPQ YRQRRFPPYH VGQTFDRRSR VLPHPNRIQA GEIGEMKDGV PEGAQLQGPV HRNPTYRPRY RSRGPPRPRP APAVGEAEDK ENQQATSGPN QPSVRRGYRR PYNYRRRPRP PNAPSQDGKE AKAGEAPTEN PAPPTQQSSA E. It is sometimes possible for the material contained within the vial of "DNA-binding protein A (CSDA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
