Nuclease-sensitive element-binding protein 1 (YBX1) Recombinant Protein | YBX1 recombinant protein

Recombinant Human Nuclease-sensitive element-binding protein 1 (YBX1)

Cat. Num. AAA958394

• Gene Names: YBX1; YB1; BP-8; CSDB; DBPB; YB-1; CBF-A; CSDA2; EFI-A; NSEP1; NSEP-1; MDR-NF1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Nuclease-sensitive element-binding protein 1 (YBX1); Recombinant Human Nuclease-sensitive element-binding protein 1 (YBX1); YBX1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-324, Full length protein
• Sequence: SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
• Sequence Length: 323

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 34098946
• NCBI GeneID: 4904
• NCBI Accession #: NP_004550.2
• NCBI GenBank Nucleotide #: NM_004559.4
• UniProt Accession #: P67809; P16990; P16991; Q14972; Q15325; Q5FVF0
• Molecular Weight: 35,924 Da
• NCBI Official Full Name: nuclease-sensitive element-binding protein 1
• NCBI Official Synonym Full Names: Y-box binding protein 1
• NCBI Official Symbol: YBX1
• NCBI Official Synonym Symbols: YB1; BP-8; CSDB; DBPB; YB-1; CBF-A; CSDA2; EFI-A; NSEP1; NSEP-1; MDR-NF1
• NCBI Protein Information: nuclease-sensitive element-binding protein 1
• UniProt Protein Name: Nuclease-sensitive element-binding protein 1
• Protein Family: Nuclease-sensitive element-binding protein
• UniProt Gene Name: YBX1
• UniProt Synonym Gene Names: NSEP1; YB1; CBF-A; DBPB; EFI-A; YB-1

NCBI Description

This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Sep 2015]

Uniprot Description

Mediates pre-mRNA alternative splicing regulation. Binds to splice sites in pre-mRNA and regulates splice site selection. Binds and stabilizes cytoplasmic mRNA. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors (). Regulates the transcription of numerous genes. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as MDR1 and HLA class II genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro). May play a role in DNA repair. Component of the CRD-mediated complex that promotes MYC mRNA stability. Binds preferentially to the 5'-[CU]CUGCG-3' motif in vitro.