Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative undecaprenyl-diphosphatase ybjG (ybjG) Recombinant Protein | ybjG recombinant protein

Recombinant Escherichia coli Putative undecaprenyl-diphosphatase ybjG (ybjG)

Gene Names
ybjG; bcrC; ECK0831; JW5112
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative undecaprenyl-diphosphatase ybjG (ybjG); Recombinant Escherichia coli Putative undecaprenyl-diphosphatase ybjG (ybjG); Recombinant Putative undecaprenyl-diphosphatase ybjG (ybjG); Putative undecaprenyl-diphosphatase ybjG EC= 3.6.1.27; Undecaprenyl pyrophosphate phosphatase; ybjG recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-198
Sequence
MLENLNLSLFSLINATPDSAPWMISLAIFIAKDLITVVPLLAVVLWLWGLTAQRQLVIKIAIALAVSLFVSWTMGHLFPHDRPFVENIGYNFLHHAADDSFPSDHGTVIFTFALAFLCWHRLWSGSLLMVLAVVIAWSRVYLGVHWPLDMLGGLLAGMIGCLSAQIIWQAMGHKLYQRLQSWYRVCFALPIRKGWVRD
Sequence Length
198
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,399 Da
NCBI Official Full Name
undecaprenyl pyrophosphate phosphatase
NCBI Official Symbol
ybjG
NCBI Official Synonym Symbols
bcrC; ECK0831; JW5112
NCBI Protein Information
undecaprenyl pyrophosphate phosphatase
UniProt Protein Name
Putative undecaprenyl-diphosphatase YbjG
UniProt Gene Name
ybjG
UniProt Entry Name
YBJG_ECOLI

NCBI Description

The ybjG gene is not essential, but UppP activity is essential to synthesize undecaprenyl phosphate, a C55 lipid carrier for cell wall synthesis, so a ybjG pgpB bacA triple mutant is lethal; overexpression, but not wildtype levels, of the LpxT(YeiU) UppP activity rescues the triple mutant (El Ghachi, 2005). [More information is available at EcoGene: EG13676]. YbjG is similar to a bacitracin resistance protein BcrC of Bacillus licheniformis. [More information is available at EcoCyc: G6439].

Uniprot Description

Function: Overexpression leads to increased undecaprenyl diphosphatase activity and to increased resistance to bacitracin. May have a preferred substrate other than undecaprenyl diphosphate in vivo. Ref.4

Catalytic activity: Ditrans,octacis-undecaprenyl diphosphate + H2O = ditrans,octacis-undecaprenyl phosphate + phosphate.

Subcellular location: Cell inner membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the BcrC/YbjG family.

Research Articles on ybjG

Similar Products

Product Notes

The ybjG ybjg (Catalog #AAA1101970) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-198. The amino acid sequence is listed below: MLENLNLSLF SLINATPDSA PWMISLAIFI AKDLITVVPL LAVVLWLWGL TAQRQLVIKI AIALAVSLFV SWTMGHLFPH DRPFVENIGY NFLHHAADDS FPSDHGTVIF TFALAFLCWH RLWSGSLLMV LAVVIAWSRV YLGVHWPLDM LGGLLAGMIG CLSAQIIWQA MGHKLYQRLQ SWYRVCFALP IRKGWVRD. It is sometimes possible for the material contained within the vial of "Putative undecaprenyl-diphosphatase ybjG (ybjG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.