Probable rRNA maturation factor YbeY (ybeY) Recombinant Protein | ybeY recombinant protein

Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)

Cat. Num. AAA1117742

• Gene Names: ybeY; ECK0651; JW0656
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable rRNA maturation factor YbeY (ybeY); Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY); ybeY recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-155, full length protein
• Sequence: MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRVVDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPLEAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE
• Sequence Length: 155

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16128642
• NCBI GeneID: 946430
• NCBI Accession #: NP_415192.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0A898; P77385
• Molecular Weight: 17,526 Da
• NCBI Official Full Name: ssRNA-specific endoribonuclease; 16S rRNA 3' end maturation and quality control co-endoribonuclease working with RNase R; rRNA transcription antitermination factor
• NCBI Official Symbol: ybeY
• NCBI Official Synonym Symbols: ECK0651; JW0656
• NCBI Protein Information: ssRNA-specific endoribonuclease; 16S rRNA 3' end maturation and quality control co-endoribonuclease working with RNase R; rRNA transcription antitermination factor
• UniProt Protein Name: Endoribonuclease YbeY
• Protein Family: Putative ribonuclease
• UniProt Gene Name: ybeY

NCBI Description

AFMB Structural Genomics target Number 122 (http://afmb.cnrs-mrs.fr/article171.html). [More information is available at EcoGene: EG13655]. YbeY shows similarity to metal-dependent hydrolases. [More information is available at EcoCyc: G6362].

Uniprot Description

Single strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA. Acts together with the RNase R to eliminate defective 70S ribosomes, but not properly matured 70S ribosomes or individual subunits, by a process mediated specifically by the 30S ribosomal subunit. Involved in the processing of 16S, 23S and 5S rRNAs, with a particularly strong effect on maturation at both the 5'-and 3'-ends of 16S rRNA as well as maturation of the 5'-end of 23S and 5S rRNAs.