Hepatitis B virus genotype D Recombinant Protein | X recombinant protein

Recombinant Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D)

Cat. Num. AAA1195021

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Hepatitis B virus genotype D; Recombinant Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D); HBx; Peptide X; pX; X recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-154aa; Full Length
• Sequence: MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA

• Species: Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for X recombinant protein

Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC). Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1 (By similarity).

References

"Analysis of hepatitis B virus populations in an interferon-alpha-treated patient reveals predominant mutations in the C-gene and changing e-antigenicity." Gunther S., Paulij W., Meisel H., Will H. Virology 244:146-160(1998)

NCBI and Uniprot Product Information

• NCBI GI #: 81984782
• UniProt Accession #: O93195
• Molecular Weight: 32.7 kDa
• NCBI Official Full Name: Protein X
• UniProt Protein Name: Protein X
• UniProt Gene Name: X
• UniProt Entry Name: X_HBVD7

Uniprot Description

Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC). Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1 ().