Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Molybdate/tungstate import ATP-binding protein WtpC (wtpC) Recombinant Protein | PH0157 recombinant protein

Recombinant Pyrococcus horikoshii Molybdate/tungstate import ATP-binding protein WtpC (wtpC)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Molybdate/tungstate import ATP-binding protein WtpC (wtpC); Recombinant Pyrococcus horikoshii Molybdate/tungstate import ATP-binding protein WtpC (wtpC); Recombinant Molybdate/tungstate import ATP-binding protein WtpC (wtpC); Molybdate/tungstate import ATP-binding protein WtpC EC= 3.6.3.-; PH0157 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-345aa; full length protein
Sequence
MLKVESISKDYREFKLREISFDVREGEHFIILGPSGSGKTVLLEIIAGIISPDRGRILLR GEDITGLPPEKRNFSYIPQNYALFPHMTVFDNIAFGLKLRKIPRKEVARKVREVAESLGI DHLLHRKPRTLSGGEQQRVAIARALVVKPELLLMDEPFANLDVQTKSKLIREMKRWRKEF GFTAIHVTHSFEEALSLGDRVGIMLRGRLVQVGDVRDVFSKPKSEEVARFLGFENIIEGV ANGRILKVGDLRIELPREVWGKVRVGIRPEDITIFMEGVKTSARNVFKARVEGIEDLGAL VKLTLNLGGIILRAFITRSSLIELGIREGEEVYASFKASAIHVFP
Sequence Length
345
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,928 Da
NCBI Official Full Name
transport-ATP binding protein
NCBI Official Symbol
PH0157
NCBI Protein Information
transport-ATP binding protein
UniProt Protein Name
Molybdate/tungstate import ATP-binding protein WtpC
UniProt Gene Name
wtpC
UniProt Entry Name
WTPC_PYRHO

Uniprot Description

Function: Part of the ABC transporter complex WtpABC involved in molybdate/tungstate import. Responsible for energy coupling to the transport system

By similarity.

Subunit structure: The complex is composed of two ATP-binding proteins (WtpC), two transmembrane proteins (WtpB) and a solute-binding protein (WtpA)

By similarity.

Subcellular location: Cell membrane; Peripheral membrane protein

By similarity.

Sequence similarities: Belongs to the ABC transporter superfamily. Sulfate/tungstate importer (TC 3.A.1.6) family. [View classification]Contains 1 ABC transporter domain.

Similar Products

Product Notes

The PH0157 wtpc (Catalog #AAA1149886) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-345aa; full length protein. The amino acid sequence is listed below: MLKVESISKD YREFKLREIS FDVREGEHFI ILGPSGSGKT VLLEIIAGII SPDRGRILLR GEDITGLPPE KRNFSYIPQN YALFPHMTVF DNIAFGLKLR KIPRKEVARK VREVAESLGI DHLLHRKPRT LSGGEQQRVA IARALVVKPE LLLMDEPFAN LDVQTKSKLI REMKRWRKEF GFTAIHVTHS FEEALSLGDR VGIMLRGRLV QVGDVRDVFS KPKSEEVARF LGFENIIEGV ANGRILKVGD LRIELPREVW GKVRVGIRPE DITIFMEGVK TSARNVFKAR VEGIEDLGAL VKLTLNLGGI ILRAFITRSS LIELGIREGE EVYASFKASA IHVFP. It is sometimes possible for the material contained within the vial of "Molybdate/tungstate import ATP-binding protein WtpC (wtpC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.