WD repeat and SOCS box-containing protein 2 (WSB2) Recombinant Protein | WSB2 recombinant protein
Recombinant Human WD repeat and SOCS box-containing protein 2 (WSB2)
Gene Names
WSB2; SBA2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WD repeat and SOCS box-containing protein 2 (WSB2); Recombinant Human WD repeat and SOCS box-containing protein 2 (WSB2); WSB2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-404, Full length protein
Sequence
MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF
Sequence Length
404
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for WSB2 recombinant protein
This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,809 Da
NCBI Official Full Name
WD repeat and SOCS box-containing protein 2 isoform 1
NCBI Official Synonym Full Names
WD repeat and SOCS box containing 2
NCBI Official Symbol
WSB2
NCBI Official Synonym Symbols
SBA2
NCBI Protein Information
WD repeat and SOCS box-containing protein 2
UniProt Protein Name
WD repeat and SOCS box-containing protein 2
Protein Family
UniProt Gene Name
WSB2
UniProt Synonym Gene Names
WSB-2
NCBI Description
This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013]
Uniprot Description
May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Research Articles on WSB2
Similar Products
Product Notes
The WSB2 wsb2 (Catalog #AAA1393191) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-404, Full length protein. The amino acid sequence is listed below: MEAGEEPLLL AELKPGRPHQ FDWKSSCETW SVAFSPDGSW FAWSQGHCIV KLIPWPLEEQ FIPKGFEAKS RSSKNETKGR GSPKEKTLDC GQIVWGLAFS PWPSPPSRKL WARHHPQVPD VSCLVLATGL NDGQIKIWEV QTGLLLLNLS GHQDVVRDLS FTPSGSLILV SASRDKTLRI WDLNKHGKQI QVLSGHLQWV YCCSISPDCS MLCSAAGEKS VFLWSMRSYT LIRKLEGHQS SVVSCDFSPD SALLVTASYD TNVIMWDPYT GERLRSLHHT QVDPAMDDSD VHISSLRSVC FSPEGLYLAT VADDRLLRIW ALELKTPIAF APMTNGLCCT FFPHGGVIAT GTRDGHVQFW TAPRVLSSLK HLCRKALRSF LTTYQVLALP IPKKMKEFLT YRTF. It is sometimes possible for the material contained within the vial of "WD repeat and SOCS box-containing protein 2 (WSB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
