Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein Wnt-8a (Wnt8a) Recombinant Protein | Wnt8a recombinant protein

Recombinant Mouse Protein Wnt-8a (Wnt8a)

Gene Names
Wnt8a; Wnt8d; Stra11; Wnt-8A; Wnt-8D
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Wnt-8a (Wnt8a); Recombinant Mouse Protein Wnt-8a (Wnt8a); Wnt8a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-354aa; Full Length of Mature Protein
Sequence
ASAWSVNNFLITRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEAELIFLEGSPDYCNRNASLSIQGTEGRECLQNARSASRREQRSCGRLCTECGLQVEERRAEAVSSCDCNFQWCCTVKCGQCRRVVSRYYCTRPVGSARPRGRGKDSAW
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Wnt8a recombinant protein
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and may be implicated in development of early embryos as well as germ cell tumors. It encodes a protein which shows 81% amino acid identity to the mouse Wnt8A protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,573 Da
NCBI Official Full Name
protein Wnt-8a
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 8A
NCBI Official Symbol
Wnt8a
NCBI Official Synonym Symbols
Wnt8d; Stra11; Wnt-8A; Wnt-8D
NCBI Protein Information
protein Wnt-8a
UniProt Protein Name
Protein Wnt-8a
Protein Family
UniProt Gene Name
Wnt8a
UniProt Synonym Gene Names
Stra11; Wnt8d

Uniprot Description

Ligand for members of the frizzled family of seven transmembrane receptors. Plays a role in embryonic patterning.

Research Articles on Wnt8a

Similar Products

Product Notes

The Wnt8a wnt8a (Catalog #AAA1418559) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-354aa; Full Length of Mature Protein. The amino acid sequence is listed below: ASAWSVNNFL ITRPKAYLTY TASVALGAQI GIEECKFQFA WERWNCPEHA FQFSTHNRLR AATRETSFIH AIRSAAIMYA VTKNCSMGDL ENCGCDESQN GKTGGHGWIW GGCSDNVEFG EKISRLFVDS LEKGKDARAL VNLHNNRAGR LAVRASTKRT CKCHGISGSC SIQTCWLQLA DFRQMGNYLK AKYDRALKIE MDKRQLRAGN RAEGRWALTE AFLPSTEAEL IFLEGSPDYC NRNASLSIQG TEGRECLQNA RSASRREQRS CGRLCTECGL QVEERRAEAV SSCDCNFQWC CTVKCGQCRR VVSRYYCTRP VGSARPRGRG KDSAW . It is sometimes possible for the material contained within the vial of "Protein Wnt-8a (Wnt8a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.