WD repeat domain phosphoinositide-interacting protein 1 (WIPI1) Recombinant Protein | WIPI1 recombinant protein

Recombinant Human WD repeat domain phosphoinositide-interacting protein 1 (WIPI1)

Cat. Num. AAA1305997

• Gene Names: WIPI1; ATG18; ATG18A; WIPI49
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: WD repeat domain phosphoinositide-interacting protein 1 (WIPI1); Recombinant Human WD repeat domain phosphoinositide-interacting protein 1 (WIPI1); WIPI1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-446, Full length protein
• Sequence: MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVCTIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQS
• Sequence Length: 446

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 1003088806
• NCBI GeneID: 55062
• NCBI Accession #: NP_001307701.1
• NCBI GenBank Nucleotide #: NM_001320772.1
• UniProt Accession #: Q5MNZ9; Q8IXM5; Q9NWF8
• Molecular Weight: 48,202 Da
• NCBI Official Full Name: WD repeat domain phosphoinositide-interacting protein 1 isoform b
• NCBI Official Synonym Full Names: WD repeat domain, phosphoinositide interacting 1
• NCBI Official Symbol: WIPI1
• NCBI Official Synonym Symbols: ATG18; ATG18A; WIPI49
• NCBI Protein Information: WD repeat domain phosphoinositide-interacting protein 1
• UniProt Protein Name: WD repeat domain phosphoinositide-interacting protein 1
• Protein Family: WD repeat domain phosphoinositide-interacting protein
• UniProt Gene Name: WIPI1
• UniProt Synonym Gene Names: WIPI49; WIPI-1; WIPI 49 kDa

NCBI Description

This gene encodes a WD40 repeat protein. Members of the WD40 repeat family are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

Plays an important role in autophagy and in particular starvation- and calcium-mediated autophagy, as well as in mitophagy. Functions upstream of the ATG12-ATG5-ATG16L1 complex and LC3, and downstream of the ULK1 and PI3-kinase complexes. Involved in xenophagy of Staphylococcus aureus. Invading S.aureus cells become entrapped in autophagosome-like WIPI1 positive vesicles targeted for lysosomal degradation. Plays also a distinct role in controlling the transcription of melanogenic enzymes and melanosome maturation, a process that is distinct from starvation-induced autophagy. May also regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway.