Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein wingless (wg) Recombinant Protein | wg recombinant protein

Recombinant Drosophila melanogaster Protein wingless (wg)

Gene Names
wg; Br; CG4889; Dint-1; Dm Wg; Dm-1; DmelCG4889; DWint-1; dWnt; DWnt-1; fg; Gla; I; int-1; l(2)02657; l(2)rO727; l(2)wg; Sp; spd; Wg; WG; wgl; wnt; Wnt; WNT; Wnt-1; Wnt/Wg; wnt1; Wnt1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein wingless (wg); Recombinant Drosophila melanogaster Protein wingless (wg); Recombinant Protein wingless (wg); Protein wingless; Protein Wnt-1 Protein int-1 dInt-1 dWnt-1; wg recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-468aa; full length protein
Sequence
GSSLSQVEGKQKSGRGRGSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLVRDNPG VLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAA VTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSR EFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVI GDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERM LNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNP EHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEV VVVERCACTFHWCCEVKCKLCRTKKVIYTCL
Sequence Length
468
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,986 Da
NCBI Official Full Name
wingless, isoform A
NCBI Official Synonym Full Names
wingless
NCBI Official Symbol
wg
NCBI Official Synonym Symbols
Br; CG4889; Dint-1; Dm Wg; Dm-1; DmelCG4889; DWint-1; dWnt; DWnt-1; fg; Gla; I; int-1; l(2)02657; l(2)rO727; l(2)wg; Sp; spd; Wg; WG; wgl; wnt; Wnt; WNT; Wnt-1; Wnt/Wg; wnt1; Wnt1
NCBI Protein Information
CG4889 gene product from transcript CG4889-RA; CG4889-PA; CG4889-PB; Wnt-1; bristled; complementation group I; flag; glazed; spade; sternopleural; wg-PA; wg-PB; wingless
UniProt Protein Name
Protein wingless
Protein Family
UniProt Gene Name
wg
UniProt Entry Name
WNTG_DROME

Uniprot Description

Function: Binds as a ligand to a family of frizzled seven-transmembrane receptors and acts through a cascade of genes on the nucleus. Segment polarity protein. May be a growth factor. Acts on neighboring cells to regulate at least one gene, the homeobox segmentation gene engrailed. Wg signal represses arm phosphorylation. Wg signaling operates by inactivating the sgg repression of engrailed autoactivation. Wg and Wnt2 have a role in the developing trachea and together are responsible for all dorsal trunk formation. Wg also acts in the developing epidermis. Acts as a morphogen, and diffuses long distances despite its lipidation. Lipophorin is required for diffusion, probably by acting as vehicle for its movement, explaining how it can spread over long distances despite its lipidation. In non-neuronal cells, wls directs wg secretion via clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps26 and Vps35) to sustain a wls traffic loop encompassing the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi. In neuronal cells (the larval motorneuron NMJ), wg signal moves across the synapse through the release of wls-containing exosome-like vesicles. Ref.11 Ref.15 Ref.16 Ref.17

Subunit structure: Monomer; folds by intramolecular disulfide bonds. Interacts with porcupine (por). Interacts with wls; in the Golgi. Ref.8 Ref.12 Ref.15

Subcellular location: Secreted. Cell junction › synapse. Membrane; Lipid-anchor. Secreted › extracellular space › extracellular matrix. Note: Palmitoylation converts wg into a membrane-anchored protein that is partitioned into specialized lipid raft microdomains before secretion. Possibly associated with the extracellular matrix. Ref.3 Ref.13 Ref.15 Ref.17

Tissue specificity: Segmented expression in embryos. In embryonic tracheal cells, expression is in stripes flanking the tracheal placode. Ref.1 Ref.11

Developmental stage: Expressed throughout development, but barely detectable in adults. Ref.1 Ref.2

Post-translational modification: Palmitoylated by porcupine, acylation is a prerequisite. The lipid group functions as a sorting signal, targeting the ligand to polarized vesicles that transport wg to unique sites at the cell surface. Major form is glycosylated at 2 sites, glycosylation is stimulated by porcupine at the ER, again acylation is a prerequisite. Ref.12

Disruption phenotype: Accumulation in the Golgi, thereby preventing secretion. Ref.16

Sequence similarities: Belongs to the Wnt family.

Research Articles on wg

Similar Products

Product Notes

The wg wg (Catalog #AAA1148052) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-468aa; full length protein. The amino acid sequence is listed below: GSSLSQVEGK QKSGRGRGSM WWGIAKVGEP NNITPIMYMD PAIHSTLRRK QRRLVRDNPG VLGALVKGAN LAISECQHQF RNRRWNCSTR NFSRGKNLFG KIVDRGCRET SFIYAITSAA VTHSIARACS EGTIESCTCD YSHQSRSPQA NHQAGSVAGV RDWEWGGCSD NIGFGFKFSR EFVDTGERGR NLREKMNLHN NEAGRAHVQA EMRQECKCHG MSGSCTVKTC WMRLANFRVI GDNLKARFDG ATRVQVTNSL RATNALAPVS PNAAGSNSVG SNGLIIPQSG LVYGEEEERM LNDHMPDILL ENSHPISKIH HPNMPSPNSL PQAGQRGGRN GRRQGRKHNR YHFQLNPHNP EHKPPGSKDL VYLEPSPSFC EKNLRQGILG THGRQCNETS LGVDGCGLMC CGRGYRRDEV VVVERCACTF HWCCEVKCKL CRTKKVIYTC L. It is sometimes possible for the material contained within the vial of "Protein wingless (wg), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.