Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

West Nile Virus Pre-M Recombinant Protein

West Nile Virus Pre-M Recombinant Protein

Applications
Western Blot, ELISA
Purity
> 95% (by SDS-PAGE)
Synonyms
West Nile Virus Pre-M; West Nile Virus Pre-M Recombinant Protein; West Nile Virus Pre-M recombinant protein
Ordering
For Research Use Only!
Host
Escherichia coli
Specificity
Immunoreactive with sera of West Nile virus infected individuals
Purity/Purification
> 95% (by SDS-PAGE)
Form/Format
20mM phosphate buffer pH7.5
Sequence
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESILRNPGYALE
Applicable Applications for West Nile Virus Pre-M recombinant protein
Western Blot (WB), ELISA (EIA)
Application Notes
Western blot standard, antibody ELISA, excellent antigen for detection of West Nile virus with minimal specificity problems.
Preparation and Storage
Protein is shipped at ambient temperature. Upon arrival, store at -20 degree C and avoid freeze-thaw cycles.
Related Product Information for West Nile Virus Pre-M recombinant protein
Description: The E Coli derived 20 kDa recombinant protein contains the West-Nile N-terminal Pre-M Virus immunodominant regions (MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTIT YECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTH GESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE).
The protein is fused with 6x His tag at C-terminal.
Introduction: West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopy reveal a 45-50 nm virion covered with a relatively smooth protein surface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins (NS1, NS2a, NS3, NS4a, NS4b, and NS5) and three structural proteins (capsid (C), membrane (M or preM), and envelope (E)). The RNA strand is held within a nucleocapsid formed from 12 kDa protein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.
Product Categories/Family for West Nile Virus Pre-M recombinant protein

Similar Products

Product Notes

The West Nile Virus Pre-M (Catalog #AAA434131) is a Recombinant Protein produced from Escherichia coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's West Nile Virus Pre-M can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). Western blot standard, antibody ELISA, excellent antigen for detection of West Nile virus with minimal specificity problems. Researchers should empirically determine the suitability of the West Nile Virus Pre-M for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVTLSNFQGK VMMTVNATDV TDVITIPTAA GKNLCIVRAM DVGYLCEDTI TYECPVLAAG NDPEDIDCWC TKSSVYVRYG RCTKTRHSRR SRRSLTVQTH GESTLANKKG AWLDSTKATR YLVKTESILR NPGYALE. It is sometimes possible for the material contained within the vial of "West Nile Virus Pre-M, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.