Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein Asterix (WDR83OS) Recombinant Protein | C19orf56 recombinant protein

Recombinant Chicken Protein Asterix (WDR83OS)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Asterix (WDR83OS); Recombinant Chicken Protein Asterix (WDR83OS); Recombinant Protein Asterix (WDR83OS); Protein Asterix; Protein WDR83OS homolog; C19orf56 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-101
Sequence
MADPRRPARVTRYKPPTTESNPALEDPTPDYMNLLGMVFSMCGLMLKLKWCAWIAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMSPPW
Sequence Length
101
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,479 Da
NCBI Official Full Name
UPF0139 membrane protein C19orf56 homolog
NCBI Official Synonym Full Names
chromosome unknown open reading frame, human C19orf56
NCBI Official Symbol
C19orf56
NCBI Protein Information
chromosome unknown open reading frame, human C19orf56; asterix
UniProt Protein Name
Protein Asterix
UniProt Gene Name
WDR83OS
UniProt Entry Name
ASTER_CHICK

NCBI Description

Asterix is expressed in the developing nervous system, apparently as an early response to fibroblast growth factor in the organizer. [provided by RefSeq, Jul 2011]

Uniprot Description

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Developmental stage: Expressed in the early neural plate of embryos. Expressed in the hypoblast and Koller's sickle at pre-primitive streak stages. At stage 4, expression is detected in the node, the lips of the streak and the epiblast in the middle of the area pellucida. By the start of neurulation, expression becomes progressively concentrated in the neural plate, neural tube and sensory placodes including lens, otic and olfactory placodes. Expressed in the notochord and the sensory placodes at stage 16. Expressed in somites and persists in the myotome at later stages. Ref.1

Induction: Up-regulated by FGF. Ref.1

Sequence similarities: Belongs to the Asterix family.

Similar Products

Product Notes

The C19orf56 wdr83os (Catalog #AAA1166280) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-101. The amino acid sequence is listed below: MADPRRPARV TRYKPPTTES NPALEDPTPD YMNLLGMVFS MCGLMLKLKW CAWIAVYCSF ISFANSRSSE DTKQMMSSFM LSISAVVMSY LQNPQPMSPP W. It is sometimes possible for the material contained within the vial of "Protein Asterix (WDR83OS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.