Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

WD repeat-containing protein 61 (Wdr61) Recombinant Protein | Wdr61 recombinant protein

Recombinant Rat WD repeat-containing protein 61 (Wdr61)

Gene Names
Wdr61; RGD1308228
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WD repeat-containing protein 61 (Wdr61); Recombinant Rat WD repeat-containing protein 61 (Wdr61); Wdr61 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-305, full length protein
Sequence
TNQYSILFKQEQAHDDAIWSVAWETNKKENIETVVTGSLDDLVKVWKWRDERLELQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQMKSIDAGPVDAWTLAFSPDSQHLATGTHMGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHVYDCPI
Sequence Length
304
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,747 Da
NCBI Official Full Name
WD repeat-containing protein 61
NCBI Official Synonym Full Names
WD repeat domain 61
NCBI Official Symbol
Wdr61
NCBI Official Synonym Symbols
RGD1308228
NCBI Protein Information
WD repeat-containing protein 61
UniProt Protein Name
WD repeat-containing protein 61
UniProt Gene Name
Wdr61

Uniprot Description

Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of KMT2A/MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Required for mono- and trimethylation on histone H3 'Lys-4' (H3K4me3), dimethylation on histone H3 'Lys-79' (H3K4me3). Required for Hox gene transcription. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1C ().

Similar Products

Product Notes

The Wdr61 wdr61 (Catalog #AAA1320644) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-305, full length protein. The amino acid sequence is listed below: TNQYSILFKQ EQAHDDAIWS VAWETNKKEN IETVVTGSLD DLVKVWKWRD ERLELQWSLE GHQLGVVSVD ISHTLPIAAS SSLDAHIRLW DLENGKQMKS IDAGPVDAWT LAFSPDSQHL ATGTHMGKVN IFGVESGKKE YSLDTRGKFI LSIAYSPDGK YLASGAIDGI INIFDIATGK LLHTLEGHAM PIRSLTFSPD SQLLVTASDD GYIKIYDVQH ANLAGTLSGH ASWVLNVAFC PDDTHFVSSS SDKSVKVWDV GTRTCIHTFF DHQDQVWGVK YNGNGSKIVS VGDDQEIHVY DCPI. It is sometimes possible for the material contained within the vial of "WD repeat-containing protein 61 (Wdr61), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.