WD repeat-containing protein 18 (wdr18) Recombinant Protein | wdr18 recombinant protein
Recombinant Danio rerio WD repeat-containing protein 18 (wdr18)
Gene Names
wdr18; zgc:92370; wu:fa16f06; wu:fb79d07
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WD repeat-containing protein 18 (wdr18); Recombinant Danio rerio WD repeat-containing protein 18 (wdr18); wdr18 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-431, Full length protein
Sequence
MSAPVEVVLSADSAGQLFNCAVYDPHTGSEFLSYRGGNTSSRSLTILNGEYILGAQLGKNYINVWEIQRKDQLQQKIVCPGIVTCLCASPDGLYVLAGIAEAIYLWEVSTGNLLAILSRHFQDLSCIKFTDDSSHFVSGGKDNLAFIWNLSSVVQLDSSRTPEPRHILSRHSLPITDIHCGLMGPQARVATASLDQTVKVWEISSGEMLLSVLFDVGIMSVTFDPCEYFLFCGGSDGNIFQVSLCSTSLSRDKTFQSDSEGNQVFKGHRNLVTCLSVSMDGTVLLSGSNDETVRMWDVQSKQCIWTINHRGPVTNAAIIPAPANMFLSDSHPAVPLPRFSRHLNPSEQGDGTGTGGMSLRLGANTQEPEGTYLEKAEELYSLMCAVTDKSVFGDGENTKVRVSELEEEVRTLKKINKDLYEFSTQLLTKPN
Sequence Length
431
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,155 Da
NCBI Official Full Name
WD repeat-containing protein 18
NCBI Official Synonym Full Names
WD repeat domain 18
NCBI Official Symbol
wdr18
NCBI Official Synonym Symbols
zgc:92370; wu:fa16f06; wu:fb79d07
NCBI Protein Information
WD repeat-containing protein 18
UniProt Protein Name
WD repeat-containing protein 18
Protein Family
UniProt Gene Name
wdr18
Uniprot Description
Involved in left-right determination through controlling the correct clustering and migration of dorsal forerunner cells (DFCs) and Kupffer's vesicle formation (PubMed:21876750). Component of the PELP1 complex involved in the nucleolar steps of 28S rRNA maturation and the subsequent nucleoplasmic transit of the pre-60S ribosomal subunit ().
Research Articles on wdr18
Similar Products
Product Notes
The wdr18 wdr18 (Catalog #AAA1336816) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-431, Full length protein. The amino acid sequence is listed below: MSAPVEVVLS ADSAGQLFNC AVYDPHTGSE FLSYRGGNTS SRSLTILNGE YILGAQLGKN YINVWEIQRK DQLQQKIVCP GIVTCLCASP DGLYVLAGIA EAIYLWEVST GNLLAILSRH FQDLSCIKFT DDSSHFVSGG KDNLAFIWNL SSVVQLDSSR TPEPRHILSR HSLPITDIHC GLMGPQARVA TASLDQTVKV WEISSGEMLL SVLFDVGIMS VTFDPCEYFL FCGGSDGNIF QVSLCSTSLS RDKTFQSDSE GNQVFKGHRN LVTCLSVSMD GTVLLSGSND ETVRMWDVQS KQCIWTINHR GPVTNAAIIP APANMFLSDS HPAVPLPRFS RHLNPSEQGD GTGTGGMSLR LGANTQEPEG TYLEKAEELY SLMCAVTDKS VFGDGENTKV RVSELEEEVR TLKKINKDLY EFSTQLLTKP N. It is sometimes possible for the material contained within the vial of "WD repeat-containing protein 18 (wdr18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
