Putative colanic biosynthesis UDP-glucose lipid carrier transferase (wcaJ) Recombinant Protein | wcaJ recombinant protein
Recombinant Escherichia coli Putative colanic biosynthesis UDP-glucose lipid carrier transferase (wcaJ)
Gene Names
wcaJ; ECK2041; JW2032
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative colanic biosynthesis UDP-glucose lipid carrier transferase (wcaJ); Recombinant Escherichia coli Putative colanic biosynthesis UDP-glucose lipid carrier transferase (wcaJ); wcaJ recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-464aa; full length protein
Sequence
MTNLKKRERAKTNASLISMVQRFSDITIMFAGLWLVCEVSGLSFLYMHLLVALITLVVFQ MLGGITDFYRSWRGVRAATEFALLLQNWTLSVIFSAGLVAFNNDFDTQLKIWLAWYALTS IGLVVCRSCIRIGAGWLRNHGYNKRMVAVAGDLAAGQMLMESFRNQPWLGFEVVGVYHDP KPGGVSNDWAGNLQQLVEDAKAGKIHNVYIAMQMCDGARVKKLVHQLADTTCSVLLIPDV FTFNILHSRLEEMNGVPVVPLYDTPLSGVNRLLKRAEDIVLATLILLLISPVLCCIALAV KLSSPGPVIFRQTRYGMDGKPIKVWKFRSMKVMENDKVVTQATQNDPRVTKVGNFLRRTS LDELPQFINVLTGGMSIVGPRPHAVAHNEQYRQLIEGYMLRHKVKPGITGWAQINGWRGE TDTLEKMEKRVEFDLEYIREWSVWFDIKIVFLTVFKGFVNKAAY
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for wcaJ recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,408 Da
NCBI Official Full Name
colanic biosynthesis UDP-glucose lipid carrier transferase
NCBI Official Symbol
wcaJ
NCBI Official Synonym Symbols
ECK2041; JW2032
NCBI Protein Information
colanic biosynthesis UDP-glucose lipid carrier transferase
UniProt Protein Name
UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase
UniProt Gene Name
wcaJ
UniProt Synonym Gene Names
UDP-Glc:Und-P Glc-1-P transferase
UniProt Entry Name
WCAJ_ECOLI
NCBI Description
Overexpression causes abnormal biofilm architecture. [More information is available at EcoGene: EG13575]. Inactivation of wcaJ results in an increase in the cellular pool of the colanic acid (CA) synthesis building block GDP-fucose, suggesting that WcaJ is involved in colanic acid synthesis . [More information is available at EcoCyc: G7098].
Uniprot Description
Is the initiating enzyme for colanic acid (CA) synthesis. Catalyzes the transfer of the glucose-1-phosphate moiety from UDP-Glc onto the carrier lipid undecaprenyl phosphate (C55-P), forming a phosphoanhydride bond yielding to glucosyl-pyrophosphoryl-undecaprenol (Glc-PP-C55). Also possesses a weak galactose-1-P transferase activity.
Similar Products
Product Notes
The wcaJ wcaj (Catalog #AAA7033587) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-464aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the wcaJ wcaj for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTNLKKRERA KTNASLISMV QRFSDITIMF AGLWLVCEVS GLSFLYMHLL VALITLVVFQ MLGGITDFYR SWRGVRAATE FALLLQNWTL SVIFSAGLVA FNNDFDTQLK IWLAWYALTS IGLVVCRSCI RIGAGWLRNH GYNKRMVAVA GDLAAGQMLM ESFRNQPWLG FEVVGVYHDP KPGGVSNDWA GNLQQLVEDA KAGKIHNVYI AMQMCDGARV KKLVHQLADT TCSVLLIPDV FTFNILHSRL EEMNGVPVVP LYDTPLSGVN RLLKRAEDIV LATLILLLIS PVLCCIALAV KLSSPGPVIF RQTRYGMDGK PIKVWKFRSM KVMENDKVVT QATQNDPRVT KVGNFLRRTS LDELPQFINV LTGGMSIVGP RPHAVAHNEQ YRQLIEGYML RHKVKPGITG WAQINGWRGE TDTLEKMEKR VEFDLEYIRE WSVWFDIKIV FLTVFKGFVN KAAY. It is sometimes possible for the material contained within the vial of "Putative colanic biosynthesis UDP-glucose lipid carrier transferase (wcaJ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
