SDS-PAGE
Fibritin (wac) Recombinant Protein | wac recombinant protein
Recombinant Enterobacteria phage T4 Fibritin (wac)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibritin (wac); Recombinant Enterobacteria phage T4 Fibritin (wac); Fibritin; Collar protein; Whisker antigen control protein; wac recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-487. Full Length of Mature Protein
Sequence
TDIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQGILDVSGDIEALAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESDVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGYPGNNSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSIGSDDIPSSIKGQIKDNTTSIESLNGIVGENTSSGLRANVSWLNQIVGTDSSGGQPSPPGSLLNRVSTIETSVSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVFLSTFLSPA
Species
Enterobacteria phage T4 (Bacteriophage T4)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for wac recombinant protein
Chaperone responsible for attachment of long tail fibers to virus particle. During phage assembly, twelve fibritin molecules attach to the phage neck via gp13: six molecules forming the collar and six molecules forming the whiskers.
Product Categories/Family for wac recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67.7 kDa
NCBI Official Full Name
Wac fibritin neck whiskers
NCBI Official Symbol
wac
NCBI Protein Information
'whisker' fibers at base of head; aid in long tail fiber attachment; fibritin
UniProt Protein Name
Fibritin
Protein Family
UniProt Gene Name
wac
UniProt Entry Name
WAC_BPT4
Uniprot Description
Chaperone involved in tail fiber assembly and retraction. Acts as a chaperone helping to attach the long tail fibers to the virus during the assembly process. During phage assembly, twelve fibritin molecules attach to the phage neck via gp13: six molecules forming the collar and six molecules forming the whiskers. to assist long.
Similar Products
Product Notes
The wac wac (Catalog #AAA1022496) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-487. Full Length of Mature Protein. The amino acid sequence is listed below: TDIVLNDLPF VDGPPAEGQS RISWIKNGEE ILGADTQYGS EGSMNRPTVS VLRNVEVLDK NIGILKTSLE TANSDIKTIQ GILDVSGDIE ALAQIGINKK DISDLKTLTS EHTEILNGTN NTVDSILADI GPFNAEANSV YRTIRNDLLW IKRELGQYTG QDINGLPVVG NPSSGMKHRI INNTDVITSQ GIRLSELETK FIESDVGSLT IEVGNLREEL GPKPPSFSQN VYSRLNEIDT KQTTVESDIS AIKTSIGYPG NNSIITSVNT NTDNIASINL ELNQSGGIKQ RLTVIETSIG SDDIPSSIKG QIKDNTTSIE SLNGIVGENT SSGLRANVSW LNQIVGTDSS GGQPSPPGSL LNRVSTIETS VSGLNNAVQN LQVEIGNNSA GIKGQVVALN TLVNGTNPNG STVEERGLTN SIKANETNIA SVTQEVNTAK GNISSLQGDV QALQEAGYIP EAPRDGQAYV RKDGEWVFLS TFLSPA. It is sometimes possible for the material contained within the vial of "Fibritin (wac), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
