Very short patch repair protein (vsr) Recombinant Protein | vsr recombinant protein

Recombinant Escherichia coli Very short patch repair protein (vsr)

Cat. Num. AAA1258465

• Gene Names: vsr; ECK1958; JW1943
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Very short patch repair protein (vsr); Recombinant Escherichia coli Very short patch repair protein (vsr); vsr recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-156, full length protein
• Sequence: ADVHDKATRSKNMRAIATRDTAIEKRLASLLTGQGLAFRVQDASLPGRPDFVVDEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIVWECALRGREKLTDEALTERLEEWICGEGASAQIDTQGIHLLA
• Sequence Length: 155

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16129906
• NCBI GeneID: 946476
• NCBI Accession #: NP_416469.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P09184
• Molecular Weight: 18,016 Da
• NCBI Official Full Name: DNA mismatch endonuclease of very short patch repair
• NCBI Official Symbol: vsr
• NCBI Official Synonym Symbols: ECK1958; JW1943
• NCBI Protein Information: DNA mismatch endonuclease of very short patch repair
• UniProt Protein Name: Very short patch repair protein
• Protein Family: Very short patch repair protein
• UniProt Gene Name: vsr

NCBI Description

Mismatch repair minimizes the effects of C methylation. [More information is available at EcoGene: EG11068]. Vsr is an endonuclease that specifically recognizes and exhibits strand-specific nicking at T:G DNA mismatches, which arise from spontaneous deamination at 5-methylcytosine, the product of Dcm (cytosine) methylation . [More information is available at EcoCyc: EG11068].

Uniprot Description

Deamination of 5-methylcytosine in DNA results in T/G mismatches. If unrepaired, these mismatches can lead to C-to-C transition mutations. The very short patch (VSP) repair process in E.coli counteracts the mutagenic process by repairing the mismatches in favor of the G-containing strand. This enzyme is an endonuclease that nicks double-stranded DNA within the sequence CT(AT)GN or NT(AT)GG next to the thymidine residue that is mismatched to 2'-deoxyguanosine. The incision is mismatch-dependent and strand-specific.