Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Pantetheinase (VNN1) Recombinant Protein | VNN1 recombinant protein

Recombinant Dog Pantetheinase (VNN1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pantetheinase (VNN1); Recombinant Dog Pantetheinase (VNN1); VNN1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-492, Full length protein
Sequence
RDTFIAAVYEHAVKLPNATLVPVSHEEALAVMNQNLDLLEAAITSAANQGAHIIVTPEDGIYGWNFSRETIYPYLEDIPDPGVNWIPCNNPKRFGYTPVQERLSCLAKDNSIYVVANIGDKKPCNASDSQCPLDGRYQYNTDVVFDSQGKLVARYHKHNLFMGENQFNVPKKPEIVTFDTIFGRFGVFTCFDILFYDPAVTLVKDFHVDTIVFPTAWMNVLPHLSAIQFHSAWAMGMGVNFLASNIHHPSKRMTGSGIYAPDSPRAFHYDMKTKEGKLLLSQLDSYTHHPIVVNWTSYASGIKAFPTENQEFTGTAFFDEFTFLELTRVTGNYTVCQKKLCCHLSYKMSEKRTDEVYALGAFDGLHVVEGRYYLQICTLLKCKTAHVHTCGGAVETASTRFDMFSLSGTFGTQYVFPEVLLSETQLAPGEFQVSSDGRLFSMKPLSGPLLTVTLFGRIYEKDQTLKASSD
Sequence Length
470
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for VNN1 recombinant protein
This gene encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. This protein, like its mouse homolog, is likely a GPI-anchored cell surface molecule. The mouse protein is expressed by the perivascular thymic stromal cells and regulates migration of T-cell progenitors to the thymus. This gene lies in close proximity to, and in the same transcriptional orientation as, two other vanin genes on chromosome 6q23-q24.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,432 Da
NCBI Official Full Name
pantetheinase
NCBI Official Symbol
VNN1
NCBI Protein Information
pantetheinase
UniProt Protein Name
Pantetheinase
Protein Family
UniProt Gene Name
VNN1
UniProt Synonym Gene Names
Vanin-1

Uniprot Description

Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.

Similar Products

Product Notes

The VNN1 vnn1 (Catalog #AAA1436019) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-492, Full length protein. The amino acid sequence is listed below: RDTFIAAVYE HAVKLPNATL VPVSHEEALA VMNQNLDLLE AAITSAANQG AHIIVTPEDG IYGWNFSRET IYPYLEDIPD PGVNWIPCNN PKRFGYTPVQ ERLSCLAKDN SIYVVANIGD KKPCNASDSQ CPLDGRYQYN TDVVFDSQGK LVARYHKHNL FMGENQFNVP KKPEIVTFDT IFGRFGVFTC FDILFYDPAV TLVKDFHVDT IVFPTAWMNV LPHLSAIQFH SAWAMGMGVN FLASNIHHPS KRMTGSGIYA PDSPRAFHYD MKTKEGKLLL SQLDSYTHHP IVVNWTSYAS GIKAFPTENQ EFTGTAFFDE FTFLELTRVT GNYTVCQKKL CCHLSYKMSE KRTDEVYALG AFDGLHVVEG RYYLQICTLL KCKTAHVHTC GGAVETASTR FDMFSLSGTF GTQYVFPEVL LSETQLAPGE FQVSSDGRLF SMKPLSGPLL TVTLFGRIYE KDQTLKASSD. It is sometimes possible for the material contained within the vial of "Pantetheinase (VNN1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.