Single-strand DNA-binding protein (virE2) Recombinant Protein | virE2 recombinant protein

Recombinant Agrobacterium tumefaciens Single-strand DNA-binding protein (virE2)

Cat. Num. AAA1251710

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Single-strand DNA-binding protein (virE2); Recombinant Agrobacterium tumefaciens Single-strand DNA-binding protein (virE2); Recombinant Single-strand DNA-binding protein (virE2); Single-strand DNA-binding protein; virE2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-146. Full length.
• Sequence: MNTNYWIGVVSEQHVLKGAAGGFAQLCHGKKAPLAKMKEGDWLIYYSPRDAYPDGKLLRSFTAIGKVKSGNIYPYQMAPNFIPYRLDIDYYPCHKIGFYDIKSKLEFVQETKHLGFLFRRGHFEISKKDFLTIAQAMGVNISGMAL
• Sequence Length: 146

• Species: Agrobacterium tumefaciens (strain 15955)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 10955163
• NCBI GeneID: 1224338
• NCBI Accession #: NP_059819.1
• NCBI GenBank Nucleotide #: NC_002377.1
• UniProt Accession #: P0A3W9; P07544; Q9JN10; P0A3W8
• Molecular Weight: 60,587 Da
• NCBI Official Full Name: hypothetical protein pTi_147
• NCBI Official Symbol: virE2
• NCBI Protein Information: type IV secretion system single-stranded DNA binding protein VirE2
• UniProt Protein Name: Single-strand DNA-binding protein
• Protein Family: Single-strand DNA-binding protein
• UniProt Gene Name: virE2
• UniProt Entry Name: VIRE2_AGRT9

Uniprot Description

Function: Involved in DNA transformation; mediates the nuclear uptake of single-stranded DNA copies of the transferred DNA (T-DNA) element. Binds single-stranded but not double-stranded DNA regardless of nucleotide sequence composition

By similarity.

Subunit structure: Forms heterodimers with the chaperone protein virE1 that prevent virE2 anarchic homopolymerization. Interacts with host VIP1 that mediates its translocation to the host nucleus and host VIP2 that promotes T-DNA integration into the host genome. Forms a complex made of VirE2, host VIP1 and VIP2 and single stranded DNA (ssDNA). Forms a complex made of virE2 and host proteins VIP1 and VBF

By similarity.

Subcellular location: Secreted

By similarity. Host nucleus

By similarity. Note: In infected cells, it is found in the nucleus

By similarity.

Induction: Targeted to degradation by the host proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(COI1) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus

By similarity.