Protein virD4 (virD4) Recombinant Protein | virD4 recombinant protein
Recombinant Agrobacterium tumefaciens Protein virD4 (virD4)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein virD4 (virD4); Recombinant Agrobacterium tumefaciens Protein virD4 (virD4); Recombinant Protein virD4 (virD4); Protein virD4; virD4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-668
Sequence
MNSSKTTPQRLAVSIVCSLAAGFCAASLYVTFRHGFNGEAMMTFSVFAFWYETPLYMGHATPVFYCGLAIVVSTSIVVLLSQLIISFRNHEHHGTARWAGFGEMRHAGYLQRYNRIKGPIFGKTCGPRWFGSYLTNGEQPHSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFELTSRARKAGGDAVFKFSPLDPERRTHCYNPVLDIAALPPERQFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKYKLFAHLAEESRNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSVYDLRRKRTCVYLCVSPNDLEVVAPLMRLLFQQVVSILQRSLPGKDERHEVLFLLDEFKHLGKLEAIETAITTIAGYKGRFMFIIQSLSALTGIYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGDYTFKARSTSYSQARMFDHNIQISDQGAPLLRPEQVRLLDDNNEIVLIKGHPPLKLRKVRYYSDRMLRRLFECQIGALPEPASLMLSEGVHRDGQDLSQQAAVTEAQGLGDIDSIPNNMEAATPQNSEMDDEQDSLPTGIDVPQGLIESDEVKEDAGGVVPDFGVSAEMAPAMIAQQQLLEQIIALQQRYGPASSHSVK
Sequence Length
668
Species
Agrobacterium tumefaciens (strain C58 / ATCC 33970)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
73,528 Da
NCBI Official Full Name
virA/G regulated protein
NCBI Official Symbol
virD4
NCBI Protein Information
type IV secretion system protein VirD4
UniProt Protein Name
Protein virD4
Protein Family
UniProt Gene Name
virD4
UniProt Entry Name
VIRD4_AGRT5
Uniprot Description
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the VirD4/TraG family.
Research Articles on virD4
Similar Products
Product Notes
The virD4 vird4 (Catalog #AAA1225502) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-668. The amino acid sequence is listed below: MNSSKTTPQR LAVSIVCSLA AGFCAASLYV TFRHGFNGEA MMTFSVFAFW YETPLYMGHA TPVFYCGLAI VVSTSIVVLL SQLIISFRNH EHHGTARWAG FGEMRHAGYL QRYNRIKGPI FGKTCGPRWF GSYLTNGEQP HSLVVAPTRA GKGVGVVIPT LLTFKGSVIA LDVKGELFEL TSRARKAGGD AVFKFSPLDP ERRTHCYNPV LDIAALPPER QFTETRRLAA NLITAKGKGA EGFIDGARDL FVAGILTCIE RGTPTIGAVY DLFAQPGEKY KLFAHLAEES RNKEAQRIFD NMAGNDTKIL TSYTSVLGDG GLNLWADPLV KAATSRSDFS VYDLRRKRTC VYLCVSPNDL EVVAPLMRLL FQQVVSILQR SLPGKDERHE VLFLLDEFKH LGKLEAIETA ITTIAGYKGR FMFIIQSLSA LTGIYDDAGK QNFLSNTGVQ VFMATADDET PTYISKAIGD YTFKARSTSY SQARMFDHNI QISDQGAPLL RPEQVRLLDD NNEIVLIKGH PPLKLRKVRY YSDRMLRRLF ECQIGALPEP ASLMLSEGVH RDGQDLSQQA AVTEAQGLGD IDSIPNNMEA ATPQNSEMDD EQDSLPTGID VPQGLIESDE VKEDAGGVVP DFGVSAEMAP AMIAQQQLLE QIIALQQRYG PASSHSVK. It is sometimes possible for the material contained within the vial of "Protein virD4 (virD4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
