Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein virB9 (virB9) Recombinant Protein | virB9 recombinant protein

Recombinant Agrobacterium tumefaciens Protein virB9 (virB9)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein virB9 (virB9); Recombinant Agrobacterium tumefaciens Protein virB9 (virB9); Recombinant Protein virB9 (virB9); Protein virB9; virB9 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-293aa; full length protein
Sequence
EDTPMAGKLDPRMRYLAYNPDQVVRLSTAVGATLVVTFATNETVTSVAVSNSKDLAALPR GNYLFFKASQVLTPQPVIVLTASDSGMRRYVFSISSKTLSHLDKEQPDLYYSVQFAYPAD DAAARRREAQQRAVVDRLHAEAQYQRKAEDLLDQPVTALGATDSNWHYVAQGDRSLLPLE VFDNGFTTVFHFPGNVRIPSIYTINPDGKEAVANYSVKGSDVEISSVSRGWRLRDGHTVL CIWNAAYDPVGQRPQTGTVRPDVKRVLKGAKG
Sequence Length
293
Species
Agrobacterium tumefaciens (strain 15955)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,172 Da
NCBI Official Full Name
hypothetical protein pTi_135
NCBI Official Symbol
virB9
NCBI Protein Information
type IV secretion system protein VirB9
UniProt Protein Name
Protein virB9
Protein Family
UniProt Gene Name
virB9
UniProt Entry Name
VIRB9_AGRT9

Uniprot Description

Function: Is essential for the biogenesis of the T-pilus, which is required for virulence and T-DNA transfer to plant cells. When is associated with virB7, might function as a nucleation center for recruitment of VirB proteins during assembly of the T-DNA transfer machine

By similarity.

Subunit structure: Heterodimer of virB7 and virB9; disulfide-linked

By similarity.

Subcellular location: Cell membrane; Peripheral membrane protein

By similarity.

Sequence similarities: Belongs to the TrbG/VirB9 family.

Research Articles on virB9

Similar Products

Product Notes

The virB9 virb9 (Catalog #AAA1096791) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-293aa; full length protein. The amino acid sequence is listed below: EDTPMAGKLD PRMRYLAYNP DQVVRLSTAV GATLVVTFAT NETVTSVAVS NSKDLAALPR GNYLFFKASQ VLTPQPVIVL TASDSGMRRY VFSISSKTLS HLDKEQPDLY YSVQFAYPAD DAAARRREAQ QRAVVDRLHA EAQYQRKAED LLDQPVTALG ATDSNWHYVA QGDRSLLPLE VFDNGFTTVF HFPGNVRIPS IYTINPDGKE AVANYSVKGS DVEISSVSRG WRLRDGHTVL CIWNAAYDPV GQRPQTGTVR PDVKRVLKGA KG. It is sometimes possible for the material contained within the vial of "Protein virB9 (virB9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.