Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human VEGFA 121 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 18 kDa.)

VEGFA 121 Recombinant Protein | VEGF121 recombinant protein

Recombinant Human VEGFA 121 Protein

Gene Names
VEGFA; VPF; VEGF; MVCD1
Purity
> 97% by SDS-PAGE.
Synonyms
VEGFA 121; Recombinant Human VEGFA 121 Protein; VEGF121; MVCD1; VEGF; VPF; VEGF121 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 muM filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
Species
Human
Endotoxin
< 1.0 EU/mug of the protein by LAL method.
Tag
No tag
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Protein Construction
High quality, high purity and low endotoxin recombinant Recombinant Human VEGFA 121 Protein (RP00017), tested reactivity in Human and has been validated in SDS-PAGE.100% guaranteed.
Preparation and Storage
Store the lyophilized protein at-20 degree C to-80 degree C for long term.
After reconstitution, the protein solution is stable at-20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human VEGFA 121 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 18 kDa.)

SDS-Page (Recombinant Human VEGFA 121 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 18 kDa.)
Related Product Information for VEGF121 recombinant protein
Description: Recombinant Human VEGFA 121 Protein is produced by e coli expression system. The target protein is expressed with sequence (Ala207-Arg327 (Lys321Asn)) of human VEGFA 121 (Accession #NP_001020541.2).
Background: This protein is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This protein is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
VEGFA
NCBI Official Synonym Symbols
VPF; VEGF; MVCD1
NCBI Protein Information
vascular endothelial growth factor A

NCBI Description

This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015]

Research Articles on VEGF121

Similar Products

Product Notes

The VEGF121 (Catalog #AAA9139620) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APMAEGGGQN HHEVVKFMDV YQRSYCHPIE TLVDIFQEYP DEIEYIFKPS CVPLMRCGGC CNDEGLECVP TEESNITMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQENCDKPR R. It is sometimes possible for the material contained within the vial of "VEGFA 121, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.