F-box protein VBF (VBF) Recombinant Protein | VBF recombinant protein
Recombinant Arabidopsis thaliana F-box protein VBF (VBF)
Gene Names
PP2-B14; AtPP2-B14; F14G9.14; F14G9_14; phloem protein 2-B14; VBF; VIP1-binding F-box protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
F-box protein VBF (VBF); Recombinant Arabidopsis thaliana F-box protein VBF (VBF); VBF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-282, Full length protein
Sequence
MMMLPEACIANILAFTSPADAFSSSEVSSVFRLAGDSDFVWEKFLPSDYKSLISQSTDHHWNISSKKEIYRCLCDSLLIDNARKLFKINKFSGKISYVLSARDISITHSDHASYWSWSNVSDSRFSESAELIITDRLEIEGKIQTRVLSANTRYGAYLIVKVTKGAYGLDLVPAETSIKSKNGQISKSATYLCCLDEKKQQMKRLFYGNREERMAMTVEAVGGDGKRREPKCRDDGWMEIELGEFETREGEDDEVNMTLTEVKGYQLKGGILIDGIEVRPKT
Sequence Length
282
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,840 Da
NCBI Official Full Name
phloem protein 2-B14
NCBI Official Symbol
PP2-B14
NCBI Official Synonym Symbols
AtPP2-B14; F14G9.14; F14G9_14; phloem protein 2-B14; VBF; VIP1-binding F-box protein
NCBI Protein Information
phloem protein 2-B14
UniProt Protein Name
F-box protein VBF
Protein Family
UniProt Gene Name
VBF
UniProt Synonym Gene Names
PP2B14; AtPP2-B14
NCBI Description
Encodes an F-box protein that can functionally replace VirF, regulating levels of the VirE2 and VIP1 proteins via a VBF-containing SCF complex. It is thought to be involved in DNA integration and T-DNA degradation.
Uniprot Description
Component of SCF(VBF) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins such as VIP1 and Agrobacterium virE2, after their implication in T-DNA translocation to the host nucleus (can functionally replace Agrobacterium VirF). Required during Agrobacterium-induced tumor formation.
Similar Products
Product Notes
The VBF vbf (Catalog #AAA1347559) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-282, Full length protein. The amino acid sequence is listed below: MMMLPEACIA NILAFTSPAD AFSSSEVSSV FRLAGDSDFV WEKFLPSDYK SLISQSTDHH WNISSKKEIY RCLCDSLLID NARKLFKINK FSGKISYVLS ARDISITHSD HASYWSWSNV SDSRFSESAE LIITDRLEIE GKIQTRVLSA NTRYGAYLIV KVTKGAYGLD LVPAETSIKS KNGQISKSAT YLCCLDEKKQ QMKRLFYGNR EERMAMTVEA VGGDGKRREP KCRDDGWMEI ELGEFETREG EDDEVNMTLT EVKGYQLKGG ILIDGIEVRP KT. It is sometimes possible for the material contained within the vial of "F-box protein VBF (VBF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
