tRNA (fMet)-specific endonuclease VapC (vapC) Recombinant Protein | vapC recombinant protein
Recombinant Salmonella typhimurium tRNA (fMet)-specific endonuclease VapC (vapC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
tRNA (fMet)-specific endonuclease VapC (vapC); Recombinant Salmonella typhimurium tRNA (fMet)-specific endonuclease VapC (vapC); vapC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-132, Full length protein
Sequence
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Sequence Length
132
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,938 Da
NCBI Official Full Name
VapC toxin family PIN domain ribonuclease
NCBI Official Symbol
STM3033
NCBI Protein Information
VapC toxin family PIN domain ribonuclease
UniProt Protein Name
tRNA(fMet)-specific endonuclease VapC
Protein Family
UniProt Gene Name
vapC
Uniprot Description
Toxic component of a type II toxin-antitoxin (TA) system. A site-specific tRNA-(fMet) endonuclease, it cleaves both charged and uncharged tRNA-(fMet) between positions 38 and 39 at the anticodon stem-loop boundary. Does not cleave tRNA(Met), tRNA(Arg2), tRNA(His), tRNA(Leu), tRNA(Phe) tRNA(Thr1), tRNA(Tyr) or tRNA(Val). Overexpression in E.coli inhibits translation, leads to loss of cell growth and degradation of tRNA(fMet), these effects are neutralized by expression of cognate antitoxin VapB. Expression also activates translation initiation at correctly positioned elongator codons (AAA and to a lesser extent AAG).
Similar Products
Product Notes
The vapC vapc (Catalog #AAA1366304) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-132, Full length protein. The amino acid sequence is listed below: MLKFMLDTNT CIFTIKNKPE HIRERFNLNT SRMCISSITL MELIYGAEKS LAPERNLAVV EGFISRLEVL DYDTQAAIHT GQIRAELARK GTPVGPYDQM IAGHAGSRGL VVVTNNLREF ERIPGIRIED WC. It is sometimes possible for the material contained within the vial of "tRNA (fMet)-specific endonuclease VapC (vapC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
