Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Vesicle-associated membrane protein 3 Recombinant Protein | Vamp3 recombinant protein

Vesicle-associated membrane protein 3

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vesicle-associated membrane protein 3; Vamp3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-103aa; full length protein
Sequence
MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Vamp3 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Vamp3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,480 Da
NCBI Official Full Name
vesicle-associated membrane protein 3
NCBI Official Synonym Full Names
vesicle-associated membrane protein 3
NCBI Official Symbol
Vamp3
NCBI Protein Information
vesicle-associated membrane protein 3
UniProt Protein Name
Vesicle-associated membrane protein 3
UniProt Gene Name
Vamp3
UniProt Synonym Gene Names
Syb3; VAMP-3; CEB
UniProt Entry Name
VAMP3_RAT

NCBI Description

may play a role in synaptic vesicle transport and membrane fusion [RGD, Feb 2006]

Uniprot Description

VAMP3: SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network. Belongs to the synaptobrevin family.

Protein type: Membrane protein, integral

Cellular Component: apical plasma membrane; cell surface; clathrin coated vesicle membrane; clathrin-coated vesicle; cytoplasmic vesicle; cytosol; intracellular; intracellular membrane-bound organelle; intracellular organelle; plasma membrane; recycling endosome; secretory granule; SNARE complex

Molecular Function: protein binding; SNAP receptor activity; SNARE binding; syntaxin-1 binding

Biological Process: calcium ion-dependent exocytosis; exocytosis; Golgi to plasma membrane protein transport; positive regulation of immunoglobulin secretion; positive regulation of receptor recycling; protein complex assembly; retrograde transport, endosome to Golgi; vesicle fusion; vesicle-mediated transport

Research Articles on Vamp3

Similar Products

Product Notes

The Vamp3 vamp3 (Catalog #AAA7043553) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-103aa; full length protein. The amino acid sequence is listed below: MSTGVPSGSS AATGSNRRLQ QTQNQVDEVV DIMRVNVDKV LERDQKLSEL DDRADALQAG ASQFETSAAK LKRKYWWKNC KMWAIGISVL VIIVIIIIVW CVS. It is sometimes possible for the material contained within the vial of "Vesicle-associated membrane protein 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.